SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025794 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025794
Domain Number 1 Region: 14-216
Classification Level Classification E-value
Superfamily L domain-like 3.57e-36
Family Ngr ectodomain-like 0.0058
Further Details:      
 
Domain Number 2 Region: 256-341
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000143
Family I set domains 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025794   Gene: ENSGACG00000019518   Transcript: ENSGACT00000025845
Sequence length 488
Comment pep:novel group:BROADS1:groupIV:25748627:25755028:-1 gene:ENSGACG00000019518 transcript:ENSGACT00000025845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLFLCLGVCPSLATCPPCCLCASDMISCSGRNLSIVPSDLPGYATLLDLSHNALTVLQTP
DWISRPFDRLATLVVSRNSISHIKVDAFTAMPHLLHLDLSFNQLIALNKSIFAGMEELKE
LLLFGNEIVQINTGAFSNLYSLQKLYLSGNRLTVFPLGLYWEPGGPRNLTFLDLSYNRLC
EVPVQSLLALTRGGGIYLQENPLVCDCALLALLEYWMWKQYRPLVDFRGGYPCRDGSGPV
SECGLEVVLEMPFEAQTYQVELGKRLRVPCPGLDAQGREVFWLTPKSVVNSSTNDPNTPL
VVLPNGTLEIWGAQMEDSGTYGCVAARGHHYNPNGSLEVNVVVGNLSTASTSGLAVGRSA
EHFNTAFTTLASCVVSIILVLLYLYLTPCRCRENRGGGSRGCGGRAFILCSDPREVESGE
RRSSGKRVAFLEPQVEDSVIGGPKTQVMNLGHIITTEGILKNSRRSTGSDSVIESNSSIS
DTNFKLSL
Download sequence
Identical sequences G3Q7D4
ENSGACP00000025794 69293.ENSGACP00000025794 ENSGACP00000025794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]