SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025824 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025824
Domain Number 1 Region: 431-679
Classification Level Classification E-value
Superfamily vWA-like 2.22e-69
Family Trunk domain of Sec23/24 0.0000811
Further Details:      
 
Domain Number 2 Region: 681-776
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 1.14e-36
Family beta-sandwich domain of Sec23/24 0.0015
Further Details:      
 
Domain Number 3 Region: 883-1024
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 8.63e-32
Family C-terminal, gelsolin-like domain of Sec23/24 0.00095
Further Details:      
 
Domain Number 4 Region: 778-882
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 1.8e-27
Family Helical domain of Sec23/24 0.0042
Further Details:      
 
Domain Number 5 Region: 149-185,214-223,251-448
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 1.02e-26
Family beta-sandwich domain of Sec23/24 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025824   Gene: ENSGACG00000019537   Transcript: ENSGACT00000025875
Sequence length 1028
Comment pep:novel group:BROADS1:groupVII:6100518:6112064:1 gene:ENSGACG00000019537 transcript:ENSGACT00000025875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQQGYVAAPPYSQAQPGMGGYQGGFGGGPAQPLYGHYGGPPQAFAAPPAGMMKSPVSSA
AGMPPPPASNQYNPNVQQNGAHPQRYPAPQAASVYGQPLQSPYNSMASMAPPPAQQLTNQ
MSSMNLGNYGKFLVSMYDGSAPGPMQSPPPPTSSVQQPFQTSPPQAMGQPQMSPGPQSPH
MSPQMSPQQSPIPFPGPPGPGGFQQPGPGAAGPPGYPQQAGQFGGNMAGHQPGMPGAFPG
APGGMAGPPQKKLDPDSIPSITQVIEDDQVKRGGQVYSTNIRGQIPPLVTTDFTVQDQGN
ASPRFMRCTTYSLPCTADLAKQCQVPLASIIKPLANLPENETPLYVVNHGETGPIRCNRC
KAYMCPYMQFIDGGRRYQCGFCNCVNEVPVFYFQHLDHMGRRVDFYERPELSLGSYEFVA
TLDYCKNNKPPNPPAYIFMIDVSYNNIKSGLVKLICDELKNLLEHLPSEEGVEASAIKVG
FVTYNKVLHFYNVKSALAQPQMMVVSDTAEMFVPLLDGFLVNYQDSRAVISNLLDQIPDM
FADTNESETVFVPVIQAGVEAFKAAECSGKLFIFQSSMPTAEAPGKLKNRDDKKLVNTDK
EKTLFQPQKGVYEQLSKECVAQGCCVDLFLFPNQYMDIATMADVPSHTGGSVYKYNNFQA
SAPTDGEHFLRDLRKDVQKSIGFDAIMRVRTSTGFRATEFFGAIHMNNTTDIEMAAVDCD
KALTVEFKHDDTLSEETGAHMQCALLYTTINGQRRLRIHNLSLNCSSQLSELYKSCETDS
LINFFSKSACRAILNQPLKTVREILVNQTAHMLACYRKNCASPSAASQLILPDAMKVFPV
YINSLMKTAPLVGSTELSTDDRAHQRLLIMGMGVEETQLLLYPRLTPLHNMDVSIKTHPA
PVRCSEERLTDSGMFLLENGHSMFLWLGQAIPPDLVQNIFNLPSLAHLQGNMCALPELDN
PLSNKVRAIINDLIEKRPNSMKLHIVRQKDKPEMVFRQFLVEDKGLHGGASYMDFLCYVH
REIRQLLT
Download sequence
Identical sequences G3Q7G4
ENSGACP00000025824 ENSGACP00000025824 69293.ENSGACP00000025824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]