SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026607 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026607
Domain Number 1 Region: 203-230,262-423
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.2e-39
Family Laminin G-like module 0.0016
Further Details:      
 
Domain Number 2 Region: 450-653
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-36
Family Laminin G-like module 0.00091
Further Details:      
 
Domain Number 3 Region: 665-855
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.91e-36
Family Laminin G-like module 0.0088
Further Details:      
 
Domain Number 4 Region: 870-1063
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.04e-34
Family Laminin G-like module 0.0017
Further Details:      
 
Domain Number 5 Region: 1072-1212,1244-1286
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.95e-30
Family Laminin G-like module 0.00000206
Further Details:      
 
Domain Number 6 Region: 21-178
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.65e-28
Family Laminin G-like module 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026607   Gene: ENSGACG00000020140   Transcript: ENSGACT00000026658
Sequence length 1598
Comment pep:novel scaffold:BROADS1:scaffold_84:231926:335416:1 gene:ENSGACG00000020140 transcript:ENSGACT00000026658 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLFAAMGLVGFYITLQVLLSTCLGLEFLGTPGQWARYLRWDASTRGDLSFQFKTEASEAL
LLYFDDGGYCDFLQLSVAGGRLQLSFSIDCAETSVLSDRRVDDSSWHFASLSRYNLRTVL
VLDGQAKADEVRPQRQFMNIVSDLFLGGVPQDIRQGALTLPTVRNTQPFRGSITDLKYGI
SLPLLLGSLKVPLESEGWCTVNPCENGGTCAVVDGEPFCDCSKTEYKGRFCSEGDVSSGP
GLNHLLLWKLFLRNNPGLAHMMAEQAREENVATFRGSEYFCYDLSQNPIQSSSDEITLSF
KTWQRNGLILHTGKSADYVNLALKDGAVSLVINLGSGAFEAIVEPVNGKFNDNSWHDVKV
TRNLRQVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKE
VVYKNNDIRLELSRLARIVDPKMKIQGEVSYKCENVATLDPISFETPEAYISLPKWNTKR
MGSISFDFRTTEPNGLILFTHGKPQERKDAARSQKNTKVDFFAVELLDGSLYLLLDMGSG
TIKVKATQTKVNDGAWYHVDIQRDGRSGTISVNSRRTPFTASGESEILDLEGDMYLGGLP
SDRTNLILPTELWTAMLNYGYVGCIRDLFIDGRSKDIRQIAEAQNGAGIKPSCNKQPGKQ
CESYPCKNRGVCKEGWNRFICDCTGTGYWSRTCEREASILSYDGSMYMKVVMPNIMHTEA
EDVSLRFRSQRAYGLLMATTSRESADTLRLELDGGRVKLTVNLDCIRINCNSSKGPETLY
AGQKLNDNEWHTVRVVRRGKTYKLTVDDDVAEGQMVGDHTRLEFHNIETGIMTERRFVSS
IPSSFIGHLQSLRFNGMLYIDLCKNGDIDYCELNARFGIRSIIADPVTFKSKSSYLSLAT
LQAYTSMHLFFQFKTTSPDGFIIFNSGDGNDFIAVELVKGYIHYVFDLGNGPNLIKGKSD
RALNDNQWHNVAITRDNSNTHTLKVDAIATTQSINGAKNLDLKGDLFIAGLGPGMYGNLP
KLVASREGYQGCLASIDLNGRLPDLLNDALFRSGQIERGCEGPSTTCQEDSCANMGICIQ
QWENYTCDCSMTSYTGIQCNDPGTTYIFGKGGGLITFKWPANERPSTRTDRLTVGFSTSL
KDGILVRIESAPGLGDYLMLHIQQGKIGVTFNIGTVDISVRESSTPVNDGKYHVVRFTRN
GGNATLQVDNWSINEHFPTDFKGNSDIERYQMANKKIPFKYARPVEEWLQEKGRQLTIFN
TQAAVAIGGSDHGRPFQGQVSGLYYNGLKVLNMAAGGNPNIKINGSVRLVGDVPSVAGSA
RTTANSPEMSTTFIETTTMMSTTTTRKHRSSSTVQKHTDEMVSSAECASDDEDQEECGTS
KVTDKTSSTSGFQGGYKAYTSRTFRPNKPSIPISRGVRTTTTAILLTADQSRTTATSAST
AHLNNVPAKQPAGKMNYRELKPQPDLVLLPLPTSFEVDSTKLRGPLITSPMFRNIPTALP
TEPGVRRVPGPSEVVRESSSTTGMVIGIVAAAALCILILLYAMYKYRNRDEGSYQVDESR
NYITNSAVQSNGAVIKDKQQSLKGSNKNQKNKDKEYYV
Download sequence
Identical sequences G3Q9P2
ENSGACP00000026607 ENSGACP00000026607 69293.ENSGACP00000026607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]