SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000027388 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000027388
Domain Number 1 Region: 815-880
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.44e-19
Family TB module/8-cys domain 0.0000725
Further Details:      
 
Domain Number 2 Region: 332-394
Classification Level Classification E-value
Superfamily TB module/8-cys domain 7.46e-17
Family TB module/8-cys domain 0.00044
Further Details:      
 
Domain Number 3 Region: 693-808
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.88e-16
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 4 Region: 1082-1148
Classification Level Classification E-value
Superfamily TB module/8-cys domain 5.1e-16
Family TB module/8-cys domain 0.0016
Further Details:      
 
Domain Number 5 Region: 476-592
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000534
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 6 Region: 640-689
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000019
Family EGF-type module 0.0033
Further Details:      
 
Domain Number 7 Region: 212-285
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.000000000196
Family TB module/8-cys domain 0.0023
Further Details:      
 
Domain Number 8 Region: 281-324
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000477
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 9 Region: 981-1026
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000634
Family EGF-type module 0.0038
Further Details:      
 
Domain Number 10 Region: 1034-1087
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000135
Family EGF-type module 0.0037
Further Details:      
 
Domain Number 11 Region: 929-975
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000391
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 12 Region: 890-939
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000559
Family EGF-type module 0.01
Further Details:      
 
Domain Number 13 Region: 1207-1252
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000978
Family EGF-type module 0.016
Further Details:      
 
Domain Number 14 Region: 83-117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000174
Family EGF-type module 0.02
Further Details:      
 
Domain Number 15 Region: 603-649
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000126
Family EGF-type module 0.0054
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000027388
Domain Number - Region: 1169-1214
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000225
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000027388   Gene: ENSGACG00000020713   Transcript: ENSGACT00000027440
Sequence length 1256
Comment pep:novel group:BROADS1:groupVII:22765560:22788367:1 gene:ENSGACG00000020713 transcript:ENSGACT00000027440 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVLISHLLVIWLSVLGLVRCTERAPAARERFKVVIAPLICKRICLKGRCRDTCEQGNNT
TLIAENGQAADTLIGQGFRVVVCPLTCMNGGVCSSRKHCLCPPGFTGRLCQFPLHQTQQA
QAARGNKQPVYPLSLKPEGQKLGEQLSIGRTQLTQTHSILTLPMSHSSEVQFNVRVHHTP
DTSVVIQPMDQSDVKPPYKMGPRLLPSRLKPKGRCFQETTPKQACNSTPLPVLTNQEDCC
GSVGNSWGQNKCYQCPKLPNASVKHTIVEDYGSTCPQGYKRYNSTHCQDINECSMQGVCQ
NGDCLNTLGSFKCSCKAGMVLERNRCVESPAEHAHCFLMASESRGCEHALPRYLTQDMCC
CTVGKAWGRNCERCPQVGTAAFSKICPAGKGYFLHETRETLAFPPIIFPRKPDKEDPKWP
ERPHAPPTAVPRPPTSTSSPRVPGSTVVKPTPPTIIRLTPGNDPLETQTKVLPKADECRL
SRNICGHGECVNSLSGYICHCHPGYHLNPQRNICEDNNECDSDPCGHGRGQCVNIEGGYK
CICRPGYKHTVQYDRVKCLDVDECSKPDICGAGGQCVNLPGSYKCECHSGFRSKSHRHLA
CEDINECLNPETCPNEQCENTPGSYECVPCLPGHEARSNTCYDIDECQKPDVCPNGVCNN
LPGSYRCECNEGFLPSSDSKSCSDVDECEDVRLCAYGHCINTEGAFQCQCYPGYQRTQEG
SHCEDINECERPSNCQRGRCINSMGSYRCDCQTGYTLVGGRRCVDIDECDADRNLCQPFG
SCKNRPGSYVCSCNHGYVLSEDKHSCEAVRVQMDEKKECYMNLDDTVFCDSVLASNVTKQ
ECCCSIGVGWGDHCEIYPCPVSQSAEFHFLCPNGQGLYYDEGLLYSLPVYHDIDECSLFA
DEICKKGRCENTQPGYECYCQQGFYYDGNLFECIDVNECHDESLCANGRCVNTEGSFYCN
CNPPWTPDSNRKKCVIPTVADDNECEDPANCKNGHCVDTPGSYYCICSLPWTLATDRNSC
VTPEEQAVSVVPFPDVNECQDPSYCKNGRCENTPGSFHCFCDPPLTFSAALKQCVYDDRT
AAHKDVCFLRVDEGLICSEPRNGMTVTYSECCCHYGRGWGPECNTCPARNSEMFSRLCQM
HWESESDGEQDFLAAFANYNPAGDSSEEDSDECSCANGRCVRSYLGTMCECNAGFRLDHS
RTRCIADIDECTEPGARVNPCKNARCVNTSGSYKCFCKHGFVATRRPNTCVRRRTR
Download sequence
Identical sequences G3QBX2
ENSGACP00000027388 69293.ENSGACP00000027388 ENSGACP00000027388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]