SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000027580 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000027580
Domain Number 1 Region: 827-890
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.44e-16
Family PHD domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000027580   Gene: ENSGACG00000020859   Transcript: ENSGACT00000027632
Sequence length 1242
Comment pep:novel group:BROADS1:groupVII:27000039:27009448:1 gene:ENSGACG00000020859 transcript:ENSGACT00000027632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ATGSSSPGLCPNYAVICSFLERYGALLDLPELTFPQLERSLQDTSSGLCDPSVPKLLVDL
HVKLLRKIGKSVSADRWEKYLVKVCQEFNTTWAWELEQNGYQELTSECKTGILKYLCECQ
FDENVKFKTAINDEDPEKMRLQPIGRDKDGQMYWFQLDQEDNVRVYLEEQDDLDGSSWKC
IVKDRNDLAEVVALLKTQIDPELLKRDQENKPEGEEKTLNLHLGEVKKLEDTSDDDSKDS
TKAARPVSPKMENDEKETEKDDLKTEASDTKLSLNGVAEGSGPAEVHAEKSSGDLDVSTK
SRSIKEEPMEACGGNASEPAAEAPRVPVKAEKAGEAKKSSAEEVQQALKDDQQAKIPLKK
RGMKYSEDFEKSSGIIVQNPLVPPLREAPTDEREKVEDTTKESCETKTGESGRRKEVESE
GSELKEASPTRGTTACETDLQKSTTPGVLQATESGDRDAPKKCPDAASVIKKTAGPATRE
TSGGRSTAGDAVGSSVIKQFAASCKPAQRPDAETKTEGDAGAASGDTETSKNSEEGKKTG
GRDNGTIRDDSKKSDTTLTAGDVKAVGHHPKAREEDKAEGDSAARKRKDASGGKDKPSSS
VEDKTTSQGAERCHMGQRVDKTEAERPSASKKDTDKEKRDTDEMKKDTEKNVDNDKEKDT
NIEKTKDTKVESKEQEGARSGTEASTKPQESAPQTAGKELDPLEKDVGPDREPGEDGGPK
SESRDEASAKGRCLRRSVRISRPTAKAVEVHDRKAEKPAKNPREKKVDQEDRPKPKMFHI
GSSFPEPSSVSVSKGRKRRRVRWSNTRSRRKKKGCRNRERRSSASSTSSDDDLPPNDDPC
KHCGLPNQPELILLCDSCDSGYHTACLRPPLMIIPDGEWFCPPCQHKLLCDKLDEQLTNL
DAALKKKERAERRKERLIYVGISLENIIAPSGEVEEEKPEIIVKEKKEAKRSKSWGRRST
RTKKSISYRFDEFDEAIEEAIEEDIKEAEGGGAGRGKDMANITGHRGKDMSTILEAGEGK
EKRRKKRRRLNDLDSDSTVEEEESEEEFRVSESSEEEFVVTENESEGESESNNSGSNGDG
KRRNASSRRRKPLKRRRSSRKRRRPRGYSDDEEEETDEEDEEEIVTEGSSEFSDSDLDVS
FRRSRRSQKKRVNYCETSESGGSQNETRPSKTKRRVRPDSSDSDGAKRRADSEEDESQQR
RRRLALKRRRASEDDESDDDSDESSEEDRPIRKRVNRIDSDD
Download sequence
Identical sequences G3QCG4
69293.ENSGACP00000027580 ENSGACP00000027580 ENSGACP00000027580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]