SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000019 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000019
Domain Number 1 Region: 65-141
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 1.38e-21
Family Ribosomal protein S15 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000019   Gene: ENSCPOG00000000023   Transcript: ENSCPOT00000000023
Sequence length 150
Comment pep:novel scaffold:cavPor3:scaffold_67:7300513:7303162:-1 gene:ENSCPOG00000000023 transcript:ENSCPOT00000000023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRMHAPGKGLSQSALPYRRSVPTWLKLSDDVKRQIYNWPRRGLTSLTDRVILRDSHGVA
QVRFVTGNKILRILKSKGLAPDLPEDLYHLIKKAVAVRKHLERNRKDKDAKFRLILIESR
IHRLARYYKTKRVLPPNWKYESSTASALVA
Download sequence
Identical sequences ENSCPOP00000000019 10141.ENSCPOP00000000019 ENSCPOP00000000019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]