SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000087 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000087
Domain Number 1 Region: 230-475
Classification Level Classification E-value
Superfamily Caspase-like 2.09e-49
Family Caspase catalytic domain 0.00019
Further Details:      
 
Domain Number 2 Region: 90-171
Classification Level Classification E-value
Superfamily DEATH domain 6.83e-20
Family DEATH effector domain, DED 0.0094
Further Details:      
 
Domain Number 3 Region: 5-73
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000235
Family DEATH effector domain, DED 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000087   Gene: ENSCPOG00000000098   Transcript: ENSCPOT00000000099
Sequence length 478
Comment pep:novel scaffold:cavPor3:scaffold_104:670009:683582:-1 gene:ENSCPOG00000000098 transcript:ENSCPOT00000000099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPAELIHQVEEALDEEEKEALAFLCRDVAVDLPPSSARDLLAALSERGQLTSLGLAELLY
RVRRFDLLKRVLGMDRVALESHLRRHPGLVSSFRVLMMEIGEDLDKSDLSALTFLMRDYT
GRGKTAKGKSFLELVIELEKLNLVAPDQLDLLEKCLKNIHRLDLKKKIEKHKQSVQGAQT
SYMNSLQASFPNLSLTELSQNLRLQNGRSTGQGLETPRQKPTKMPIQESGALSSQYVPVE
RYRMQSKPLGICLIIDCVGNATEVLRGAFSSVGFKVQCFLYLKVGDMVQILRQVASSPQH
QHHDSFVCVLVSRGDPHRVFGVDLAHEGLPLEQVRTMFTGDACPPLIGKPKLFFIQSYLV
SEAPLGASSLPEVDGPAVTSVESTKPWPQPHELHREADILWSHCTAQACLLELPEASQSL
YLQGLSQQLLQDRRHPLLDLHVELNRRVYDWNSTVPPWQRYSLALKHTLRKTLILAST
Download sequence
Identical sequences ENSCPOP00000000087 10141.ENSCPOP00000000087 ENSCPOP00000000087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]