SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000088 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000088
Domain Number 1 Region: 53-104
Classification Level Classification E-value
Superfamily GLA-domain 1.35e-18
Family GLA-domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000088   Gene: ENSCPOG00000000099   Transcript: ENSCPOT00000000100
Sequence length 225
Comment pep:known scaffold:cavPor3:scaffold_92:5858421:5877130:-1 gene:ENSCPOG00000000099 transcript:ENSCPOT00000000100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTLLILFSQLPIVTLALPRYTRAAKDSRHAPEEVFASKEEANFFIHRRLLYNRFDLELF
LPSNLERECMEEFCSYEEAREIFLDEHKTMEFWKEYSVKGPTPKSDSRREKIDVIHILIG
IIAGGTLLVTLGLCLYYVCITKCKRQPHAGGSVAYVRNGSFSINLRRPEEATSAPLAPSL
EDAGLPSYEQAMELSRKRSISPPPPYPGLAKGFRVFKKSMSLPSH
Download sequence
Identical sequences A0A286XTB3
ENSCPOP00000000088 10141.ENSCPOP00000000088 XP_003463896.1.53824 ENSCPOP00000000088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]