SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000160 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000160
Domain Number 1 Region: 73-255
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.3e-74
Family F-box associated region, FBA 0.00000141
Further Details:      
 
Domain Number 2 Region: 11-88
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000000209
Family F-box domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000160   Gene: ENSCPOG00000000185   Transcript: ENSCPOT00000000186
Sequence length 284
Comment pep:known scaffold:cavPor3:scaffold_25:22651455:22654887:-1 gene:ENSCPOG00000000185 transcript:ENSCPOT00000000186 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APHPTMALASINELPESILLELFTHVPARHLLLHCRPVCSLWRDLIDLVTLWKRKCLREG
FVTRDWDQPVADWKVFYFLCSLRRNLLHNPCAEEDMTGWKLDANGGDRWKVESLPGEHGT
NFPDPEVKKYFVTSYDLCLKSQLVDLKAKGYWEDLLDRIRPDIVVKDWFAARRDCGCTYQ
IQVQLVSADYICLASFRPPPVTMHQWNDASWTEVSHTFSDYPPGVRHILFQHGGQDTQYW
AGWYGPRVTNSSIIVSNKMTRKPAPSTTLSDKAGAEEAAPSPSR
Download sequence
Identical sequences 10141.ENSCPOP00000021145 ENSCPOP00000000160 ENSCPOP00000021145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]