SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000294 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000294
Domain Number 1 Region: 8-253
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.34e-41
Family Nitrogenase iron protein-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000294   Gene: ENSCPOG00000000337   Transcript: ENSCPOT00000000340
Sequence length 285
Comment pep:known scaffold:cavPor3:scaffold_115:2112050:2127485:-1 gene:ENSCPOG00000000337 transcript:ENSCPOT00000000340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRYAQLVMGPAGSGKSTYCATMVQHCEALNRSVQVVNLDPAAEHFSYPVMADIRELIEV
DDVMEDDSLRFGPNGGLVFCMEYFANNFDWLENCLGHVEDDYILFDCPGQIELYTHLPVM
KQLVQQLEQWEFRVCGVFLVDSQFMVESFKFISGILAALSAMISLEIPQVNIMTKMDLLS
KKAKKEIERFLDPDMYSLLEDSTSDLKSKKFKKLTKAVCGLIDDYSMVRFLPYDQSDEES
MNIVLQHIDFAIQYGEDLEFKEPREHEDESSSSMFDEYFQESQNE
Download sequence
Identical sequences H0UTP5
XP_003462981.1.53824 ENSCPOP00000000294 ENSCPOP00000000294 10141.ENSCPOP00000000294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]