SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000459 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000459
Domain Number 1 Region: 328-473
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.77e-22
Family Regulator of G-protein signaling, RGS 0.0033
Further Details:      
 
Domain Number 2 Region: 553-690
Classification Level Classification E-value
Superfamily PX domain 7.33e-22
Family PX domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000459   Gene: ENSCPOG00000000525   Transcript: ENSCPOT00000000530
Sequence length 945
Comment pep:known scaffold:cavPor3:scaffold_12:42025290:42104456:1 gene:ENSCPOG00000000525 transcript:ENSCPOT00000000530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSWVRTMGEKLKQRLRLDVGREICRQYPLFCFLLLCLSAASLILNRYLHILMIFWSFVA
GVVTFYCSLGPDSLLPNIFFTIKYKPKQLGLQELFPQGHSCAVCGKVKCKRHRPSLLLEN
YQPWLDLKISSKVDASLSEVLELVLENFVYPWYRDVTDDESFVDELRVTLRFFASVLIRR
THKVDIPSIITKKLLKAAMKHIEVIVKARQKVKNTEFLQHAALEEYGPELHVALRSRRDE
LHYLRKLTELLFPYILPPKATDCRSLTLLIREILSGSVFLPSLDFLADPDTVNHLLLIFI
DDSPPEKATEPPSPLVPFLQKFAEPRNKKPSVLKLELKQIREQQDLLFRFMNFLKQEGAV
HVLQFCLTVEEFNDRILRPELSNDEMLSLHEELQKIYKTYCLDESIDKIRFDPFIVEEIQ
RIAEGPYIDVVKLQTMRCLFEAYEHVLSLLENVFTPMFCHSDEYFRQLLRGAESPTRNSK
FNRGSLSLDDFRSTQRRGESFGISRIGSKIKGVFKSTAMEGAMLPNYGVAEGEDDFIEEG
IVVMEDDSPVEAVSTPNAPRNLAAWKISIPYVDFFEDPSERKEKKERIPVFCIDVERNDR
RAVGHEPEHWSVYRRYLEFYVLESKLTEFHGTFPDAQLPSKRIIGPKNYEFLKSKREEFQ
EYLQKLLQHPELSNSQLLADFLSPNGGETQFLDKILPDVNLGKIIKSVPGKLMKEKGQHL
EPFIMNFINSCESPKPKPSRPELTILSPTSENNKKLFNDLFKNNANRAENIERKQNQNYF
MEVMTIEGVYDYLMYVGRVVFQVPDWLHHLLMGARILFKNTLEMYTDYYLHCKLQQLFQE
HRLVSLITLLRDAIFCENTEPRSLQDKQKAAKKTFEEMMNYIPDLIVKCIGEETKYESIR
LLFDGLQQPVLNKQLTYVLLDIVIQELFPELNKVQKEVTSMTSWM
Download sequence
Identical sequences ENSCPOP00000000459 10141.ENSCPOP00000000459 ENSCPOP00000000459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]