SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000665 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000665
Domain Number 1 Region: 659-846
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.67e-58
Family Nucleotide and nucleoside kinases 0.000000155
Further Details:      
 
Domain Number 2 Region: 393-492
Classification Level Classification E-value
Superfamily PDZ domain-like 5.78e-33
Family PDZ domain 0.0000283
Further Details:      
 
Domain Number 3 Region: 495-609,652-686
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-31
Family SH3-domain 0.0000956
Further Details:      
 
Domain Number 4 Region: 240-335
Classification Level Classification E-value
Superfamily PDZ domain-like 2.23e-27
Family PDZ domain 0.0000226
Further Details:      
 
Domain Number 5 Region: 133-239
Classification Level Classification E-value
Superfamily PDZ domain-like 3.02e-27
Family PDZ domain 0.0000933
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000665   Gene: ENSCPOG00000000746   Transcript: ENSCPOT00000000751
Sequence length 850
Comment pep:known scaffold:cavPor3:scaffold_26:27160994:27223606:-1 gene:ENSCPOG00000000746 transcript:ENSCPOT00000000751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHKHQHCCKCPECYEVTRLAALRRLEPPGYGDWGQVPDPYGPGAGNGATSSYGGYSSQTL
PSQAGATPTPRTKAKLIPTSRDVGPVPPKPVPGKSTPKLNGSGPSWWPECTCTNRDWYEQ
ASSAPLLVNPEALESSLSVNGSDGMYKYEEIVLERGNSGLGFSIAGGIDNPHVPDDPGIF
ITKIIPGGAAAMDGRLGVNDCVLRVNEVDVSEVVHSRAVEALKEAGPVVRLVVRRRQPPP
ETIMEVNLLKGPKGLGFSIAGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQIGDRLLAV
NNTNLQDVRHEEAVASLKNTSDMVYLKVAKPGSLHLNDMYAPPDYASTFTALADNHISHN
SSLGYLGAVESKVSYPAPPQVPPTRYSPIPRHMLAEEDFTREPRKIILHKGSTGLGFNIV
GGEDGEGIFVSFILAGGPADLSGELRRGDRILSVNGVNLRNATHEQAAAALKRAGQSVTI
VAQYRPEEYSRFESKIHDLREQMMNSSMSSGSGSLRTSEKRSLYVRALFDYDRTRDSCLP
SQGLSFSYGDILHVINASDDEWWQARLVTPHGESEQIGVIPSKKRVEKKERARLKTVKFH
ARTGMIESNRDFPGLSDDFYGAKNLKGVTSNTSDSESSSKGQEDAILSYEPVTRQEIHYA
RPVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQ
DNKFIEAGQFNDNLYGTSIQSVRAVAERGKHCILDVSGNAIKRLQQAQLYPIAIFVKPKS
IEALMEMNRRQTYEQANKIYDKAMKLEQEFGEYFTAIVQGDSLEEIYNKIKQIIEDQSGH
YIWVPSPEKL
Download sequence
Identical sequences A0A286XRJ2
ENSCPOP00000000665 10141.ENSCPOP00000000665 ENSCPOP00000000665 XP_003471059.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]