SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000705 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000705
Domain Number 1 Region: 219-482
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.28e-73
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000232
Further Details:      
 
Domain Number 2 Region: 9-92
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000642
Family MarR-like transcriptional regulators 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000705   Gene: ENSCPOG00000000787   Transcript: ENSCPOT00000000792
Sequence length 508
Comment pep:known scaffold:cavPor3:scaffold_42:13325111:13333158:1 gene:ENSCPOG00000000787 transcript:ENSCPOT00000000792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADGPVAEQLLRRLEVADGGLDSAELATQLGVEHQAVVGAVKSLQALGEVIEAELRSTKR
WELTAEGEEIAQEGSHEARVFRSIAPEGLAQSALMQLPSGKVGFSKAMSNKWIRVDKSAA
DGPRVFRVVEKVEDEVQRRLQLVQKGQAEKLSEKERSELRKRKLLTEVTLKTYWVSKGSA
FSTSVSKQETELSPEMISSGSWRNQPFKPYNFSARGVLPDSGHLHPLLKVRSQFRQIFLE
MGFTEMPTDNFIESSFWNFDALFQPQQHPARDQHDTFFLRDPAEALQLPTDYVHRVKRTH
AQGGYGSQGYKYSWRLDEARKNVLRTHTTAASARALYRLAQKKPFTPVKYFSIDRVFRNE
TLDATHLAEFHQIEGVVADHGLTLGHLMGVLREFFSKLGITQLRFKPTYNPYTEPSMEVF
SYHQGLKKWVEVGNSGLFRPEMLLPMGLPENVSVIAWGLSLERPTMIKYGINNIRELVGH
KVNLQMVYDSPLCRLDTEPRPQKTQAAA
Download sequence
Identical sequences H0UUQ7
10141.ENSCPOP00000000705 XP_003468404.1.53824 ENSCPOP00000000705 ENSCPOP00000000705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]