SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000747 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000747
Domain Number 1 Region: 32-91
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000481
Family VWC domain 0.0000869
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000000747
Domain Number - Region: 1271-1312
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.0837
Family Fibrinogen C-terminal domain-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000747   Gene: ENSCPOG00000000832   Transcript: ENSCPOT00000000838
Sequence length 1478
Comment pep:known scaffold:cavPor3:scaffold_9:51843763:51846648:1 gene:ENSCPOG00000000832 transcript:ENSCPOT00000000838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHLGPLQTLVLLTLLVAAVLRCQGQDIRKNPSCLQNGQRYNDKDVWKPEPCRICVCDEG
IVLCDSVICEDIQDCPNPEILFGECCPICPADLTTASGRQPGPKGQKGEPGDIKDIVGPK
GPPGPQGPAGEQGPRGDRGEKGEKGSPGPRGRDGEPGTPGKSKYPYFPSWAAPPAMRPNF
AAQMAGGFDEKAGGAQMGVMQGPMGPMGPRGPPGPAGAPGPQGFQALPAFPQRKVVQGPM
GPRGPPGPPGKSGDDEGKLGKPGKSGERGPPGPQGARGFPGTPGLPGVKGHRGYPGLDGA
KGEAGAPGVKGESGSPGENGSPGPMGPRGLPGERGRTGPAGAAGARGNDGQPGPAGPPGP
IGPAGGPGFPGAPGAKGEAGPTGARGPEGAQGPRGEPGNPGSPGPAGASGNPGTDGIPGA
KGSAGAPGIAGAPGLRWAGSVEKTQCESLPVFSFQGEPGIAGFKGEQGPKGETGPAGPQG
APGPAGEEGKRGARGEPGGVGPIGPPGERGAPGNRGFPGQDGLAGPKGAPGERGPSGLAG
PKGANGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPG
VMGFPGPKGANGEPGKAGEKGLAGAPGLRGLPGKDGETGAAGPPGPAGPAGERGEQGAPG
PSGFQGLPGPPGTPGESGKPGEQGVPGEAGAPGLVGPRGERGFPGERGSPGAQGLQGARG
LPGTPGTDGPKGAAGPVGPPGAQGPPGLQGMPGERGAAGIAGPKGDRGDVGEKGPEGAPG
KDGGRGLTGPIGPPGPAGANGEKGEVGPPGPAGSAGARGAPGERGETGPPGPAGFAGPPG
ADGQPGAKGEQGEAGQKGDVGSPGPQGPSGAPGPQGPTGVTGPKGSRGAQGPPGVTGFPG
AAGRVGPPGSNSARGRAGPCNLPCSAGKDGPKGVRGDSGPPGRAGDPGLQGPAGPPGEKG
EPGDDGVSGADGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGASGDRG
PPGPVGPPGLTGPAGEPGREGSPGADGPPGRDGAAGVKGDRGETGAVGAPGATGKQGDRG
EAGAQGPMGPAGPAGARGIPGPQGPRGDKGESGEPGERGVKGHRGFTGLQGLPGPPGPSG
DQGASGPAGPSGPRGPPGPVGPSGKDGANGIPGPIGPPGPRGRSGETGPAGPPGNPGPPG
PPGPPGPGIDMSAFAGLGQREKGPDPLQYMRADEAASTLRQHDVEVDATLKSLNNQIESI
RSPEGSRKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCNMETGETCVYPNPA
NVPKKNWWSSKTKEKKHIWFGETINGGFHFSYGDDNLAPNTANVQMTFLRLLSTEGSQNI
TYHCKNSIAYLDEAAGNLKKALLIQGSNDVEIRAEGNSRFTYTVLKDGCTKHTGKWGKTV
IEYRSQKTSRLPIIDIAPMDIGGPEQEFGVDLGPVCFL
Download sequence
Identical sequences ENSCPOP00000000746 10141.ENSCPOP00000000746 ENSCPOP00000000747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]