SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000752 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000752
Domain Number 1 Region: 16-251
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.01e-78
Family Calponin-homology domain, CH-domain 0.000000461
Further Details:      
 
Domain Number 2 Region: 2842-2966
Classification Level Classification E-value
Superfamily EF-hand 2.18e-49
Family EF-hand modules in multidomain proteins 0.00000656
Further Details:      
 
Domain Number 3 Region: 2968-3063
Classification Level Classification E-value
Superfamily EF-hand 2.96e-38
Family EF-hand modules in multidomain proteins 0.0000194
Further Details:      
 
Domain Number 4 Region: 1924-2080
Classification Level Classification E-value
Superfamily Spectrin repeat 6.34e-25
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 5 Region: 3043-3131
Classification Level Classification E-value
Superfamily RING/U-box 5.65e-21
Family ZZ domain 0.0092
Further Details:      
 
Domain Number 6 Region: 311-418
Classification Level Classification E-value
Superfamily Spectrin repeat 6.81e-20
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 7 Region: 2506-2634
Classification Level Classification E-value
Superfamily Spectrin repeat 2.1e-19
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 8 Region: 388-526
Classification Level Classification E-value
Superfamily Spectrin repeat 2.49e-16
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 9 Region: 2034-2179
Classification Level Classification E-value
Superfamily Spectrin repeat 2.62e-16
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 10 Region: 1181-1333
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000531
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 11 Region: 494-631
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000763
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 12 Region: 2232-2335
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000798
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 13 Region: 2659-2794
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000288
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 14 Region: 1492-1647
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000125
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 15 Region: 968-1082
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000134
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 16 Region: 2392-2519
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000408
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 17 Region: 2804-2841
Classification Level Classification E-value
Superfamily WW domain 0.0000000000905
Family WW domain 0.00023
Further Details:      
 
Domain Number 18 Region: 743-900
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000144
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 19 Region: 1620-1745
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000149
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 20 Region: 1090-1191
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000054
Family Spectrin repeat 0.0053
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000000752
Domain Number - Region: 1306-1399
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000198
Family Spectrin repeat 0.0073
Further Details:      
 
Domain Number - Region: 1414-1509
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000696
Family Spectrin repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000752   Gene: ENSCPOG00000000837   Transcript: ENSCPOT00000000843
Sequence length 3430
Comment pep:known scaffold:cavPor3:scaffold_68:2565725:3056748:-1 gene:ENSCPOG00000000837 transcript:ENSCPOT00000000843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKYGDREARPDDGQNEFSDIIKSRSDEHNDVQKKTFTKWINARFSKSGKPPINDMFTDL
KDGRKLLDLLEGLTGTSLTKERGSTRVHALNNVNRVLQVLHQNNVELVNIGGTDIVDGNH
KLTLGLLWSIILHWQVKDVMKDVMSDLQQTNSEKILLSWVRQSTRAYSQVNVLNFTTSWT
DGLAFNALLHRHKPDLFSWDRVVKMSPIERLEHAFNKAQSYLGIEKLLDPEDVAVQLPDK
KSIIMYLTSLFEVLPQQITIDAIREVETLPRKYKKECEEEEINIQSPAAAEEHESPRADT
PSTVTEVDMDLDSYQIALEEVLTWLLSAEDTFQEQDDISDDVEEVKEQFATHEAFMMELT
AHQSSVGSVLQAGNQLITQGTLSDEEEFEIQEQMTLLNARWEALRVESMERQSRLHDVLM
ELQKKQLQQLSAWLTLAEERIQKMETCSLDDNLESLQKLLEEHKSLQNDLEAEQMKVNSL
THMVVIVDENSGESATALLEDQLQKLGERWTAVCRWTEERWNRLQEINILWQELLEQQCL
LKAWLTEKEEALNKVQTSNFKDQKELSVSVRRLAILKEDMEMKRQTLDQLSEICQDVGQL
LDNPKASKKMNSDSEELTQRWDSLVQRLEDSSNQVTQAVAKLGMSQIPQKDLLETVRVRE
QVTTKKSKQELPPPPPPKKRQIHVDTEAKKKFDAVSVELLNWILKSKTAIQATEIKEYKK
TQETSEMKKKLKELEKEQAERSPWLDELKQTGQTLLEQMGKEGLSTDEIKHILEKILSEW
KTISQHLVDLTRKVKLQEDINAYFKQLNELEKIVKTKEEWVQHAAFSQAPQRPLSSLEDS
CQRELTSLLDLQPKIEMVRVSCSALQSEASVPRFVQADLDSFMGRLQAVMMALQGHQQQL
AKERKSQPGREYLEALKALKEGLGDVERKAQTSLRVLGQPAELEKALQGRKALGEILEKQ
KPALHKLAEETKALEKNLLPDVENTYKQEFSDAQEKWNKLKVTVSEDLRLLEETASKLRA
FEADSKVIEKWMGDVKDFLTEEQADQGDDVGLQRQLDQCSAFVSEIETIESSLKNMKDIE
THFRSCPVAGMQTWVQTRLVNYQTQLEKYSKEIAVQKNRLSESQEKAVNLKKDLAEMQEW
MSQAEEEYLERDFEYKSPEELEGAVEEMKRAKEDVLQKEVRVKILRDNIKLLAAKVPSGG
QELTSELNVVLENYQLLCNRIRGKCHTLEEVWSCWIELLHYLDLETTWLNTLEERVRSTE
ALPEKTEAVSEALEALESVLRHPADNRTQIRELGQTLIDGGILDEIISEKLEAFNSRYED
LSHLAESKQISLEKQLQVLRETDHMLQVLQESLGELDKQLTSYLTDRIDAFQVPQEAQRI
QAEISAHELTLEELRRTLRSQPPASPEGRTARGGSQVDVLQRKLREVSTKFQLFQKPANF
EQRMLDCKRVLEGVQTELHVLEVKDVDPEVVQSHLEKCMKLYKTLSEVKLEVETVIKTGR
HIVQKQQTDNPKGMDEQLTSLKVLYNELGAQVTEGKQDLERASQLARKVKKEAASLSEWL
SATEAELVQKSASEGVLGDLDTEISWAKNVLKDLEKRKADLNAITENSAALQNLIVGSEP
VLEERLCLLNAGWSRVRTWTEDWCNTLMNHQNQLEMFDGNVAHISTWLYQAEALLDEIEK
KPASKREEIVKRLLSELDDASLQVENAREQAVILMNTRGSSNRELVEPKLAELDRNFEKV
SQHIKSAKLLIGQEPTSHPCVVTTEAFRASVPFSDLDKLEKDIESMLKVVEKHLEHSDGS
EEMDEERAQIEEVLQRGEQMLHQPMEDSKKETIRLQLLLLHTRYHKIKAIPIQQRKTSQL
TSGVRSSSLPADYLVEINKILLTMDGVELSLNVPELNTTVYEDFSFQEDSLKNIKDQLDR
LGEQIAVVHEKQPDVILEASGPEAIQIRDMLSQLNAKWDRVNRMYNDRKSHFDRAVEEWR
QFHCDLNDLTQWITEAEEMLVDTCAADGSLDLEKARTHQRELEEGISSHQLSMAAVNRLG
DGIVQQLPPAHGRFLRDKLAALNKRWSAVLAHVKTRQPRLRGESKQVLDYRRKLEEMLCW
LAKAENTVQKKPATELGENLPELQDLRQEMETQAEQLKWLNRTELEMLADKSLSLHERDK
LSESLRGVNATWNKICREVPSTLKETTQEPCCVSQTRIAAHPGAQKVVLVSSASEVPAQA
HRSSEMSVPADLDQTITELADWLVLIDQMLKSNIVTVGDVEEINKTVSRMKITKADLEQR
HPQLDFVFTLAQNLKNKASSSDVRTAITEKLEKVQTHWDGTQHGVELRRQQLEAMVADSL
RWEDRREEAEELVRRAEARLFSLQQARRDPLTKQVADNQLLLQELAPGDGIITAFDNVLQ
KLLQDYASDDTRNVKETTEYLKTSWVNLKQSVADRQSALEAELRTAQASRRDLDNFLKWV
QEAETTVNLLADASQRENARQDSSLVGELRQQLQDIQAEIDAHNDIFKSIDGNRQKMVKA
LGNSEEATMLQHRLDDMNQRWNDLKAKSASIRAHLEASAEKWNRLLASLEELIKWLNMKD
EELKKQMPIGGDVPALQLQYDHCKALRRELKEKEYSVQNAVDQARVFLADQLIEAPEEPR
RNLQSKTELTPEERAQKIAKAMRKQSSEVREKWQSLNAVTSNWQKQVDKALEKLRDLQGA
MDDLDADLKEAEAVRNGWKPVGDLLIDSLQDHIEKTMAFREEIAPINLKVKAVNDLSSQL
SPLDLHPSLKMSRQLDDLNMRWKLLQVSVDDRLKQQEAHRDFGPSSQHFLSTSVQLPWQR
SISHNKVPYYINHQTQTTCWDHPKMTELFQSLADLNNVRFSAYRTAIKIRRLQKALCLDL
LELNTTNEVFKQHKLNQNDQLLSVPDVINCLTTTYDGLEQMHKDLVNVPLCVDMCLNWLL
NVYDTGRTGKIRVQSLKIGLMSLSKGLLEEKYRYLFNEVAGPTEMCDQRQLGLLLHDAIQ
IPRQLGEVAAFGGSNIEPSVRSCFHQNNNKPEISVKEFIDWMRLEPQSMVWLPVLHRVAA
AETAKHQAKCNICKECPIVGFRYRSLKHFNYDVCQSCFFSGRTAKGHKLHYPMVEYCIPT
TSGEDVRDFTKVLKNKFRSKKYFAKHPRLGYLPVQTVLEGDNLETPITLISMWPEHYDPS
QSPQLFHDDTHSRIEQYATRLAQMERTNGSFLTDSSSTTGSVEDEHALIQQYCQTLGGES
PVSQPQSPAQILKSVEREERGELERIIADLEEEQRNLQVEYEQLKEQHLRRGLPVGSPPD
SIVSPHHTAEDSELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQPEPDS
RINGVSPWASPQHSALSYSPDPDPGQHFQQAAAEDLLAPPDDTSTDLTEVMEQINNTFPS
CCSNVPSRPQ
Download sequence
Identical sequences ENSCPOP00000000752 ENSCPOP00000000752 10141.ENSCPOP00000000752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]