SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000783 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000783
Domain Number 1 Region: 301-500,666-885,923-954
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 2.56e-130
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0000000327
Further Details:      
 
Domain Number 2 Region: 515-667
Classification Level Classification E-value
Superfamily ValRS/IleRS/LeuRS editing domain 6.41e-55
Family ValRS/IleRS/LeuRS editing domain 0.0000299
Further Details:      
 
Domain Number 3 Region: 956-1215
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 2.99e-51
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00011
Further Details:      
 
Domain Number 4 Region: 87-209
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 7.52e-21
Family Glutathione S-transferase (GST), C-terminal domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000000783
Domain Number - Region: 1202-1264
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.0523
Family Valyl-tRNA synthetase (ValRS) C-terminal domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000783   Gene: ENSCPOG00000000870   Transcript: ENSCPOT00000000876
Sequence length 1270
Comment pep:known scaffold:cavPor3:scaffold_15:41163787:41174102:1 gene:ENSCPOG00000000870 transcript:ENSCPOT00000000876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSILYVSPAPRCLPSLRALIAARYGEAGAGPGWGGAHPRICLQPPPASRAPFPPPRLPAL
EQGPGGLWVWGAAAVAQLLWPAGLGGPGGSQEAVLVQQWVSYADTELIPAACGATLPALG
LRSPAQDPQAALGALGKALQPLEEWLRLHTYLAGNAPSLADLAAVTALLLPFRYVLDPSA
RQIWGSVTRWFSACVQQPEFRAVLGEVVLCSGTRSPCQQSGPESPAPPKTAAQLKKEAKK
REKLEKFQQKQRLQQQQPHTWIFVSSEQKRPKAEKKEKRDLGVITYDLPTPPGEKKDVSG
PMPDSYSPQYVEAAWYPWWEQQGFFKPEYGRPSVSTPNPRGIFMMCIPPPNVTGSLHLGH
ALTNAIQDSLTRWHRMRGETTLWNPGCDHAGIATQVVVEKKLWRERGLSRHQLGREAFLQ
EVWKWKEEKGDRIYHQLKKLGSSLDWDRACFTMDPKLSAAVTEAFVRLHEEGVIYRSTRL
VNWSCALNSAISDIEVDKKELTGRTLLSVPGYKEKVEFGVLVSFAYKVQDSDSDEEVVVA
TTRIETMLGDVAVAVHPEDARYQHLKGKRVTHPFVSRSLPIVFDHFVDMEFGTGAVKITP
AHDQNDYEVGQRHGLEAISIMDVHGALVNVPPPFLGLPRFEARKAVLAALKERGLFRGVR
DNPMVVPLCNRSKDVVEPLLRPQWYVRCGEMAQAASAAVTRGDLRILPEAHQRTWHSWMD
NIRDWCISRQLWWGHRIPAYFITVNDSAVPPGEDPDSRYWVSGRSEAEALEKAAAEFGVS
PDKISLKQDEDVLDTWFSSGLFPFSILGWPSQSEDLSVFYPGTLLETGHDILFFWVARMV
MLGLKLTGKLPFREVYLHAIVRDAHGRKMSKSLGNVIDPLDVIHGVSLQGLHDQLLNSNL
DPSEVEKAKEGQKADFPAGIPECGTDALRFGLCAYTSQGRDINLDVNRILGYRHFCNKLW
NATKFALRGLGQGFVPSPTSTPAGRGSLVDRWILSRLAEAVRLSSEGFQAYDFPAVTTAQ
YSFWLYELCDVYLECLKPVLSGSDQEVAECARQTLYTCLDVGLRLLSPFMPFVTEELFQR
LPRRSPQAPASLCVTPYPEPAECSWKDPEAEAALELALSISRAVRSLRADYGLTRTRPDC
FLEVADEATGAVASAVSGYVQALASAGVVAVLALGAPAPQGCAVALASDRCSIHLQLQGL
VDPARELSKLQAKQAEAQRQAQRLQERRSASGYAVKVPLEVQEADEAKLRQTEAELKKVD
EAIALFQKML
Download sequence
Identical sequences ENSCPOP00000000783 10141.ENSCPOP00000000783 ENSCPOP00000000783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]