SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000861 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000861
Domain Number 1 Region: 559-651
Classification Level Classification E-value
Superfamily DEATH domain 1.45e-22
Family DEATH domain, DD 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000861   Gene: ENSCPOG00000000959   Transcript: ENSCPOT00000000965
Sequence length 657
Comment pep:known scaffold:cavPor3:scaffold_14:41353660:41382703:-1 gene:ENSCPOG00000000959 transcript:ENSCPOT00000000965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSATPPLFSLPEARARFAKSTREALNNKNIKPLSSTFNQLPGSENEKKCTLDQAFRGILE
EEIINHSSCENVLAIISLAIGGVTGGICTASTPFVLLGDVLDCLPLDQCDTIFTFVEKNV
ATWKSSTFYSAGKNYLLRMCNDLLRRLSKSQNTVFCGRIQLFLARLFPLSEKSGLNLQSQ
FNLENVTVFNTNEQESTLGQKHPEDREEGMDVEEGEMGDDEAPTTCSIPIDYNLYRKFWS
LQDYFRNPVQCYEKVSWKTFLKYSEEVLAVFKSYKLDDTQASRKKMEELKTGGEHVYFAK
FLTSEKLMDLQLSDSNFRRHILLQYLILFQYLKGQVKFKSSNYVLTDEQSLWIEDTTKSV
YQLLSENPPDGERFSKMVEHILNTEENWNSWKNEGCPSFVKERASDSKPMRVVRKRTAPE
DFLGKGPNKKILMGNEELTRLWNLCPDNMEACKSETREYMPTLEEFFEEAIEQADPENMV
ESEYKAVNNSNYGWRALRLLARRSPHFFQPTNQQFKSLPEYLENMVIKLAKELPPPSEEI
KTGEDEDEEDNDALLKENESPDVRRDKPVTGEQIEIFASKLGEHWKILAPHLEMKDSEIR
QIECDSEDMRMRARQLLVAWQDQEGIHATPDNLINALNKSGLGDLAESLTNDNETNS
Download sequence
Identical sequences H0UV41
ENSCPOP00000000861 10141.ENSCPOP00000000861 XP_013012609.1.53824 ENSCPOP00000000861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]