SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000886 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000886
Domain Number 1 Region: 6-291
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.64e-80
Family Protein kinases, catalytic subunit 0.000000000272
Further Details:      
 
Domain Number 2 Region: 350-664
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.26e-77
Family Ankyrin repeat 0.0000156
Further Details:      
 
Domain Number 3 Region: 1302-1392
Classification Level Classification E-value
Superfamily DEATH domain 1e-17
Family DEATH domain, DD 0.0046
Further Details:      
 
Domain Number 4 Region: 673-709,785-893
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000145
Family Atu3015-like 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000886   Gene: ENSCPOG00000000987   Transcript: ENSCPOT00000000994
Sequence length 1430
Comment pep:known scaffold:cavPor3:scaffold_11:14316151:14492721:-1 gene:ENSCPOG00000000987 transcript:ENSCPOT00000000994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVFRQENVDDYYDTGEELGSGQFAVVKKCRAKSTGLQYAAKFIRKRRTKSSRRGVSRED
IEREVGILKEIQHPNIITLHEVYESKTDVVLILELVAGGELFDFLAEKESLTEEEATEFL
KQILNGVYYLHSLQIAHFDLKPENIMLLDRNVPKPRIKIIDFGLAHKIDFGNEFKNIFGT
PEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANVSAVNYEFEEEY
FRNTSALAKDFIRRLLVKDPKKRMTIQDSLQHPWIKPKDTQQALSRKASAVNMEKFKKFA
ARKKWKQSVRLISLCQRLSRSFLSRSNVSVARSDDTLDEEDSFVMKAIIHAINDDNVPGL
QHLLGSLSNYDVNQPSKHGTPPLLIAAGCGNIQILQLLLKRGSRIDVQDKGGSNAVYWAA
RHGHVDTLKFLSENKCPLDVKDKSGETALHVAARYGHADVVQLLCSFGSNPDFQDKEEET
PLHCAAWHGYYSVAKALCEAGCNVNIKNREGETPLLTASARGYHDIVECLAEHGADLNAC
DKDEHIALHLAVRRCQMEVIKTLISQGCPVDFQDRHGNTPLHVACKDGNVPIVVALCEAN
CALDISNKYGRTPLHLAANNGILDVVRYLCLMGASVEALTLDGKTAEDLAKSEQHEHVAG
LLARLRKDTHRGLFIQQLRPTQNLQPRIKLKLFGHSGSGKSTLVESLKCGLLRSFFRRRR
PRLSSTSSTRFPPSPLATKPTVSVSINNLYPGCENVSVRSRSMMFEPRLTKGMLEVFVAP
SHHLHCSADDQSTKAIDIQNAYLNGIGDFSVWEFSGNPVYFCCYDYFAVNDPTSIHIIVF
SLEEPYEIQLNQVIFWLSFLKSLVPVEEPIAFGGKLKNPLRVVLVATHADIMNVPRPAGG
EFGYDKDMSLLKEIRNRFGNDLHISNKLFVLDAGASGSKDMKVLRNHLQEIRSQIVSGCP
PMTHLCEKIISILPSWRKLNGPNQLMSLQQFVYDVQDQLNPLASEEDLRRIAQQLHSIGE
INIMQSETVQDVLLLDPRWLCTNVLGKLLSVETPRALHHYRGRYTMEDIQRLVPDSDVEE
LLQILDAMDICARDLSSGTMVDVPALIKTDNLQRSWAEEEDDIMVYGGVRIVPVEHLTPF
PCGIFHKVQVNLCRWIHQQSVEGDADIRLWVSGCKVTNRGAELLVLLVNHGQGIEVQVRG
LETEKIKCCLLLDSVCSTIENVMSTTLPGLLTVKHYLSPQQLREHHEPIMVYHPRDFFRA
QTLRESSLTNTMGGYRESFSSITCFGCHDVYSQASLGMDIHASDLNLLTRRKLSRLLDPP
DPMGKDWCLLAMNLGLPDLVAKYNSSTGAPGDFLPSPLHALLQEWTSYPESTVGVLVSKL
RELGRRDAADFLLKASSVFKINFDGSGQEAYASSCNSGTSYNSISSVVSR
Download sequence
Identical sequences H0UV62
10141.ENSCPOP00000000886 ENSCPOP00000000886 XP_003475107.1.53824 ENSCPOP00000000886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]