SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000893 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000000893
Domain Number - Region: 24-72
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0824
Family Regulator of G-protein signaling, RGS 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000893   Gene: ENSCPOG00000000993   Transcript: ENSCPOT00000001001
Sequence length 362
Comment pep:known scaffold:cavPor3:scaffold_37:4883856:4902442:1 gene:ENSCPOG00000000993 transcript:ENSCPOT00000001001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRPSLLLKNILKCTLLVFGVWILYILKLNYVSEECDMKKKHYVDPDRIKRAQRYAQQIL
QKECRPRFVKTAMARLFAHRYSVDLPPFVEKVSGASKAEDKYDPPFGFHTLSNKVQSLLE
LLPEHDFPKHLKAKHCRRCVVIGSGGVLYGLELGQALNQFDTVIRLNSAPVEGYSEHVGN
KTTIRMTYPEGAPLSDAEYYANDLFVTVLFKSVDFSWLQAMLKRETLPFWIRLFFWKQVA
EKIPLQPKHFRILNPVIIKETAFDILQYSEPQSRFWGRDKNIPTIGIIAVVLATHLCDEV
SLAGFGYDLSQPRTPLHYFDNLCMAAMNWQTMHNVTTETKFLQKLVKEGVVTDLSGGIHC
EF
Download sequence
Identical sequences ENSCPOP00000000893 10141.ENSCPOP00000000893 ENSCPOP00000000893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]