SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001009 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001009
Domain Number 1 Region: 338-422
Classification Level Classification E-value
Superfamily DEATH domain 4.71e-22
Family DEATH domain, DD 0.0000133
Further Details:      
 
Domain Number 2 Region: 88-126
Classification Level Classification E-value
Superfamily TNF receptor-like 2.47e-16
Family TNF receptor-like 0.00015
Further Details:      
 
Domain Number 3 Region: 34-86
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000000273
Family TNF receptor-like 0.000086
Further Details:      
 
Domain Number 4 Region: 127-168
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000017
Family TNF receptor-like 0.0001
Further Details:      
 
Domain Number 5 Region: 169-192
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000848
Family TNF receptor-like 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001009   Gene: ENSCPOG00000001114   Transcript: ENSCPOT00000001126
Sequence length 430
Comment pep:known scaffold:cavPor3:scaffold_53:8122918:8137122:-1 gene:ENSCPOG00000001114 transcript:ENSCPOT00000001126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASRAGATGRAMDGPRLLLLQLLLLGVSLGGAKEACSSGLYTHGGECCKACNLGEGVAQPC
GANQTVCEPCLDSVTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDE
VTGRCEACSVCEAGSGLVYSCQDKQNTVCEECPDGTYSDEANHVDPCLPCTVCEDTERQL
RECTRWADAECEEIPGRWITRSTPPEGADGTVPGTQEPEAPPEQDIVASTVADVVTTVMG
SSQPVVTRGTADDLIPIYCSILAAVVVGLVAYIVFKRWNSCKQNKQGANSRPANQTPPPE
GEKLHSDSGISVDSQSLHDQQSHTQTAQGQALKGDSGLYSSLPPAKREEVEKLLNGSAGD
TWRHLAGELGYQPEHIDSFTREACPTRAMLSTWAAQDSATLDALLAALRRIQRADIVESL
CSESTATSPV
Download sequence
Identical sequences 10141.ENSCPOP00000001009 ENSCPOP00000001009 ENSCPOP00000001009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]