SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001068 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001068
Domain Number 1 Region: 193-477
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.7e-46
Family Protein kinases, catalytic subunit 0.00087
Further Details:      
 
Domain Number 2 Region: 4-94
Classification Level Classification E-value
Superfamily DEATH domain 3.03e-25
Family DEATH domain, DD 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001068   Gene: ENSCPOG00000001184   Transcript: ENSCPOT00000001196
Sequence length 624
Comment pep:known scaffold:cavPor3:scaffold_87:575158:643110:-1 gene:ENSCPOG00000001184 transcript:ENSCPOT00000001196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGFIYQLPARVLDELCRSLDALSECDWMQLASYVITDLTQLQRIKAMERVQGVSITREL
LWWWGMRQATVQQLLDLLGHLELHRAAHIVRSWKQGPETSSSLPAFPGPVPPGSAAAFLR
SSEEDQDVGKPLEPAACQGRGGALPRARQLASVLLLSEEDTACPIKTDSPATLHSKNFST
SVPKQARPLSCSGASLLWSEADVIQATSNFHPSHRISSSTFADVYRGQRHGVPLVVKQLR
VAACSASVSLERFLRAEVQVCLRCCHANVLPLLGFCTGGQCHSLIYPYMANGSLQDRLQG
QDSSDPLPWTQLVSICSGLLCAVEHLHGLDIIHGNVKSSNILLDEEFTPKLAHPVVQLCS
VDKRSEYTVMKTHLFQASAAYVPEDFIRVGQLTKRVDIFSCGIVLAEVLTGMPAMDSDRS
PVYLKDLLLSEIPSSRKPGVQKVMAKEICQKYLKKRGGSLPEDCTEALATAVYHCLWRRN
SSLWEPKARSSVVAVEERLRAPGALLQWSGLSAGAGCPANTPVETGDVDFAGLQAAVSAT
AANSAGTEAEVEGCKRASLGPGTVGAAAVRPSLPSFLIPLKIQPSRSTPETSWKIEINEA
KRKLMENILLYKEEKLDSIELFGP
Download sequence
Identical sequences 10141.ENSCPOP00000001068 ENSCPOP00000001068 ENSCPOP00000001068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]