SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001361 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001361
Domain Number 1 Region: 1-88
Classification Level Classification E-value
Superfamily DEATH domain 3.06e-21
Family Pyrin domain, PYD 0.0000846
Further Details:      
 
Domain Number 2 Region: 109-193
Classification Level Classification E-value
Superfamily DEATH domain 1.7e-17
Family Caspase recruitment domain, CARD 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001361   Gene: ENSCPOG00000001505   Transcript: ENSCPOT00000001525
Sequence length 195
Comment pep:known scaffold:cavPor3:scaffold_4:46091196:46092461:-1 gene:ENSCPOG00000001505 transcript:ENSCPOT00000001525 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGARDAILEVLENLTCEEFKKFKLKLLTVQLRGGYERIPRGTLSLMDAIDLSDKLVSYY
LEEYGTELTATVLCNMGMQELAERLQEYRREGPGAPPAAIRDPPRKAAQPAQHFVDQHRQ
ALIYRVSEVNGLLDALYGTVLSDEQYQQVRAESTSQQKMRKLYSFTVSWDLRCKDLLLKA
LRDTHPYLVADLEPC
Download sequence
Identical sequences A0A286XDV9
ENSCPOP00000001361 10141.ENSCPOP00000001361 XP_003478302.1.53824 ENSCPOP00000001361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]