SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001362 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000001362
Domain Number - Region: 5-52
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.06
Family Calponin-homology domain, CH-domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001362   Gene: ENSCPOG00000001506   Transcript: ENSCPOT00000001526
Sequence length 403
Comment pep:known scaffold:cavPor3:scaffold_4:23503714:23546042:1 gene:ENSCPOG00000001506 transcript:ENSCPOT00000001526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFRDLRNFIEMMRALGYPRHISMENFRTPNFGLVSEVLLWLVKRYEPQTDIPSDVETEQ
DRVFFIKAVAQFMATKAHIKLNTKKLYQADGYAVKELLKITSVLYNAMKTKGMEGSKVGE
EDISKFKFDLSSKIADLKAARQLASEITSKGAFLYDLLGKEVELRELRTEAIARPLEINE
TEKVMRIAVKEILSQVQKTKDLLSNVASDEANLEAKIEKRKLELERNRKRLQTLQSVRPA
FMDEYEKIEEELQKQYDIYLEKFRNLAYLEQQLEEHHRMEQERFEEAENTLRLMQNKLKE
EEKRLLKSGSNDDSEIDIQEDDESDSELEERQLSKPRTAIEVLMQGRPGKHIVGTMQGGD
SDDDENSEDSEIDLEDESLALSPAKPNRRVQKPEPLDESDNDF
Download sequence
Identical sequences ENSCPOP00000001362 10141.ENSCPOP00000001362 ENSCPOP00000001362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]