SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001469 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001469
Domain Number 1 Region: 831-915
Classification Level Classification E-value
Superfamily DEATH domain 6.28e-24
Family DEATH domain, DD 0.0000456
Further Details:      
 
Domain Number 2 Region: 139-231
Classification Level Classification E-value
Superfamily Immunoglobulin 2.48e-16
Family I set domains 0.025
Further Details:      
 
Domain Number 3 Region: 230-281
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000392
Family TSP-1 type 1 repeat 0.0005
Further Details:      
 
Domain Number 4 Region: 284-338
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000222
Family TSP-1 type 1 repeat 0.00076
Further Details:      
 
Domain Number 5 Region: 33-135
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000169
Family I set domains 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001469   Gene: ENSCPOG00000001628   Transcript: ENSCPOT00000001649
Sequence length 921
Comment pep:known scaffold:cavPor3:scaffold_22:30545682:30688152:1 gene:ENSCPOG00000001628 transcript:ENSCPOT00000001649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLTIFSLSSCLPDDDFFHELPETFPSDPPEPLPHFLIEPEEAYIVKNKPVNLYCKASPAT
QIYFKCNSEWVHQKDHIVDERVDETSGLIVREVSIEISRQQVEELFGPEDYWCQCVAWSS
AGTTKSRKAYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPVAEVEWLKNEDIID
PVEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRRSTTATVIVYVNGGWSTWTEW
SVCNSRCGRGFQKRTRTCTNPAPLNGGAFCEGQSVQKIVCTTLCPVDGRWTSWSKWSTCG
TECTHWRRRECTAPAPKNGGKDCDGLVLQSKNCTDGLCMQSFIYPISTEQRTQNEYGFSS
APDSDDVALYVGIVIAVIVCLAISVIVALFVYRKNHRDFESDIIDSSALNGGFQPVNIKA
ARQDLLAVPPDLTSAAAVYRGPVYALHDVSDKIPMTNSPILDPLPNLKIKVYNTSGAVTP
QDDLSEFTSKLSPQMTQSLLENEALNLKNQSLARQTDPSCTAFGTFNSLGGHLIIPSSGV
SLLIPAGAIPQGRVYEMYLTVHRKENMRPAMEDGQTLLTPVVSCGPPGALLTRPVVLTLH
HCADPSTEDWKIQLKNQAAQGQWEDVVVVGEENFTTPCYIQLDAEACHILTENLSTYALV
GQATTKAAAKRLKLALFGPLCCSSLEYSIRVYCLDDTQDALKEVLQLERQMGGQLLEDPK
SLHFKGSTHNLRLSVHDVAHSLWKSKLLAKYQEIPFYHIWNGSQRNLHCTFTLERFSLNT
VELVCKLCVRQVEGEGQIFQLNCTVSEEPTGMDLPLLDPASTITTVTGPSAFSIPLPIRQ
KLCSSLDAPQTRGHDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQNFPDGNLSMLA
AVLEEMGRHETVVSLAAEGQY
Download sequence
Identical sequences ENSCPOP00000001469 10141.ENSCPOP00000001469 ENSCPOP00000001469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]