SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001499 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001499
Domain Number 1 Region: 315-520
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.7e-59
Family Nucleotide and nucleoside kinases 0.00012
Further Details:      
 
Domain Number 2 Region: 153-300
Classification Level Classification E-value
Superfamily SH3-domain 1.84e-29
Family SH3-domain 0.00083
Further Details:      
 
Domain Number 3 Region: 64-167
Classification Level Classification E-value
Superfamily PDZ domain-like 7.89e-21
Family PDZ domain 0.00087
Further Details:      
 
Domain Number 4 Region: 20-71
Classification Level Classification E-value
Superfamily L27 domain 0.00000000000282
Family L27 domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001499   Gene: ENSCPOG00000001663   Transcript: ENSCPOT00000001684
Sequence length 525
Comment pep:known scaffold:cavPor3:scaffold_39:12638614:12718864:1 gene:ENSCPOG00000001663 transcript:ENSCPOT00000001684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QIHEKLHYYEKQSPVPILHGAAALADDLAEELQNKPLSSEIRELLKLLSKPNVKALLSVH
DTVAQKNYDPVLPAMPDDIDDEEDSVKIIRLVKNREPLGATIKKMSRTGAIVVARVMRGG
AAHRSGLIHVGDELREVNGIPVEDKRPEEIIQILAQSQGAITFKIIPSIKEETPSKEGKM
FLRALFDYDPNEDKAIPCKEAGLSFKRGDILQIMSQDDATWWQAKHEGAANPRAGLIPSK
HFQERRLALRRPEILVQPLKVSNRKSSGFRRSFRLSRKDKKTNKSMYECKKSDQYDTADV
PTYEEVTPYRRQMNEKYRLVVLVGPVGVGLNELKRKLLISDTQHYGVTVPHTTRARRSQE
SDGVEYIFISKHLFETDVQNNKFIEYGEYKNNYYGTSIDSVRSVLAKNKVCLLDVQPHTV
KHLRTLEFKPYVIFIKPPSIERLRETRKNAKIISSRDDQGAAKPFTEEDFQEMIKSAQIM
EGQYGHLFDKIIINDDLTVAFNELKTTFDKLETETHWIPVSWLHS
Download sequence
Identical sequences ENSCPOP00000001499 ENSCPOP00000001499 10141.ENSCPOP00000001499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]