SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001602 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001602
Domain Number 1 Region: 159-452
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.34e-68
Family Protein kinases, catalytic subunit 0.0000645
Further Details:      
 
Domain Number 2 Region: 1-114
Classification Level Classification E-value
Superfamily DEATH domain 1.32e-38
Family DEATH domain, DD 0.00000195
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001602   Gene: ENSCPOG00000001771   Transcript: ENSCPOT00000001792
Sequence length 458
Comment pep:novel scaffold:cavPor3:scaffold_9:55897368:55914172:-1 gene:ENSCPOG00000001771 transcript:ENSCPOT00000001792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALI
QTGKSPTSELLFDWGTTNCTVGDLVDILIQNEFFAPASLLLPDAVPKPVNTLPSKETVTI
QQEHLSVYEKSSTPVTPVQILDQNCIPPGSSGPENRSLEVSDTCFKSFSNQELKSVTNNF
DERPISLGGSKMGEGGFGVVYKGYVNNTTVAVKKLAAMVDISTEELKQQFDQEIKVMAKC
QHENLVELLGFSDGDDLCLVYVYPNGSLLDRLSCLDDTPPLSWHMRCKIAQGAANGISFL
HENHHIHRDIKSANILLDKDFTAKISDFGLARASEKLTQTVMTSRIVGTTAYMAPEALRG
EITPKSDIYSFGVVLLEIITGLPAVDEKREPQLLLDIKEEIEDEEKTIEDYVDVKMKDAD
STSVETMYFVASQCLHEKKNKRPDIKKVQQQLQEITSS
Download sequence
Identical sequences 10141.ENSCPOP00000001602 ENSCPOP00000001602 ENSCPOP00000001602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]