SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001631 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001631
Domain Number 1 Region: 99-382
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.23e-77
Family Protein kinases, catalytic subunit 0.0000167
Further Details:      
 
Domain Number 2 Region: 32-112
Classification Level Classification E-value
Superfamily SH3-domain 1.19e-20
Family SH3-domain 0.00055
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000001631
Domain Number - Region: 401-469
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00247
Family Regulator of G-protein signaling, RGS 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001631   Gene: ENSCPOG00000001803   Transcript: ENSCPOT00000001824
Sequence length 1083
Comment pep:known scaffold:cavPor3:scaffold_20:15180866:15259053:-1 gene:ENSCPOG00000001803 transcript:ENSCPOT00000001824 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPSRALLGGLASAAAAAPAAVAPGELGCDAPLPYWTAVFEYEAAGEDELTLRLGDVVEV
LSKDSQVSGDEGWWTGQLNQRVGIFPSNYVTPRSAFSSRCQPGGEDPSCYPPIQLLEIDF
AELTLEEIIGIGGFGKVYRAFWIGDEVAVKAARYDPDEDISQTIENVRQEAKLFAMLKHP
NIIALRGVCLKEPNLCLVMEFARGGPLNRVLSGKRIPPDILVNWAVQIARGMNYLHDEAI
VPIIHRDLKSSNILILQKVENGDLSNKILKITDFGLAREWHRTTKMSAAGTYAWMAPEVI
RASMFSKGSDVWSYGVLLWELLTGEVPFRGIDGLAVAYGVAMNKLALPIPSTCPEPFAKL
MEDCWNPDPHLRPSFMSILDQLTTIEESGFFEMPKDSFHCLQDDWKHEIQEMFDQLRAKE
KELRTWEEELTRAALQQKNQEELLRRREQELAEREIDILERELNIIIHQLCQEKPRVKKR
KGKFRKNRLKLRDGNRISLPSDFQHKFTVQASPTMDKRKSLINSHSSPPASPTIIPRLRA
IQLTPGESSKTWGRNSVIPKEEGEEEEKRVPKKKGRTWGPGTLGQKELSSGDEGSPQRRE
RANGLSTPSESPHFHLGLKSLVDGYRQWSSSAPNLGKGPRNSPALPGFTSLMEMEDEDSE
GLRSGENRLQHSPNQPYLCIPFPRGEDGDGPPGDGVHEEPTPVNSATSTPQLTPTNSLKR
SGTHQRRCEMALLGCGAVLAATGLGFDLLEAGRCQLVPPEEPEPPVREEKKRREGLFQRA
SRPRRSTSPPSRKLFKKEEPTLLLGDPSASLTLLSLSSISECNSTRSLLRSDSDEIVVYE
MPVSPVEAPPPTPCTHNPLVNVRVERFKRDPNQSLTPTHVTLTAPTQPSGHRRTPSDGAL
KPAAPVASQSPSSNGLSPSHGAGVPKTPSPSRDPGEFPRLPDPNVVFPPTPRRWNTQQDS
TLERPKTLEFLPRPRPSANRQRLDPWWFVSPSHARSASPANSSSTETPSNLDSCFASSSS
TVEERPGLPALLPFQPGPLPDTERTLLDLDAEGQSQDSTVPLCRAEMNTHRSTPYEIQQE
FWS
Download sequence
Identical sequences ENSCPOP00000001631 ENSCPOP00000001631 10141.ENSCPOP00000001631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]