SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001637 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001637
Domain Number 1 Region: 1346-1484
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.1e-62
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000151
Further Details:      
 
Domain Number 2 Region: 235-335
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000000038
Family Calponin-homology domain, CH-domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001637   Gene: ENSCPOG00000001809   Transcript: ENSCPOT00000001830
Sequence length 1490
Comment pep:known scaffold:cavPor3:scaffold_12:21495892:21587944:-1 gene:ENSCPOG00000001809 transcript:ENSCPOT00000001830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDAADPREMRKTFIVPAIKPFDHYDFSRAKIACNLAWLVAKAFGTENVPEELREPFYTD
QYDQEHIKPPVVNLLLSAELYCRAGSLILKSDAAKPLLGHDAVIQALAQKGLYVTDQEKL
VTERDLHKKPIQMSAHLAMIDTLMMAYTVEMVSVEKVIACAQQYSAFFQATDLPYDIEDA
VMYWINKVNEHLKDIIEQEQKLKEHHTVEAPGGQKSPSKWFWKLVPARYRKEQTLLKQLP
CIPLVENLLKDGTDGCALAALIHFYCPGVVRLEDICLKETMSLADSLYNLQLIQEFCQEY
LNQCCHFTLEDMLYAASSIKSNYLVFMAELFWWFEVVKPSFVQPRIVCPQGAEPVKAFPS
IPVLNAAKRNVLDSSCSSDFTSSGEGAGFTQYHHLPSRYSHPQAHSSTSVGIRRSSSMSY
VDGFIGTWPKEKRSSVHGVSFDISFDKEDSVQRSTPNRGITRSISNEGLTLNNNRLPKHI
RKNLSFKPVNGEEEAESIEEELNVDPHSDLKSYLPSKRNTDELNSNENMHYKLPNGALQN
RVLLDEFGNQIETPSIEEALQIIHDTEKSPRTPRPDQIANGFFLHSQEMSILNSNVKLSQ
SSPDNITDTKGALSPITDTTEVDTGIHVPSEDIPETMDEDSSLRDYTVSLDSDMDDASKF
LQDYDIRTNNLREASSPCPSTISTKSQPGSSASSSSGVKMTSFAEQKFRKLNHTDGKSSG
SSSQKTTPEGSELNIPHVVAWAQIPEETGLPQGRDTTQLLASEMVHLRMKLEEKRRAIEA
QKKKMEAAFTKQRQKMGRTAFLTVVKKKGDGISPLREEAAGAEDEKVYTDRAKEKEFQKT
DGQRSKSLVDIKESMENPPTKWLKSPTTPVDSEKQWNLASPSEENLNEGEILEYTKSIEK
LNSSLHLLQQEMQRLSLQQEMLMQMREQQSWVISPPQPSPQKQIRDFKPSRQAGLSSTVA
PFSSDSPRPTHPSPQSSNRKSTSFSVKNQRTPRPNELKITPLNRTLTPPRSVDSLPRLRR
FSPSQVPIQTRSFVCFGDDGEPQLKESKLKEEAKKEDLECKGALEQQGHNPQEKEMKPFE
STVSEVLSQPVTETVCLTPEDQLTQPTEPLPKPIFPPVTPKNVNLIEVSLSDLKPPEKAD
VSVEKYDGESDKEQFDDDQKVCCGFFFKDDQKAENDMAMKRAALMEKRLRREKESQLRKQ
QLEAEMEHRKEETRRKTEEERQKKEDEKARREFIRQEYMRRKQLKMEDMDTVIKPRPQVV
KQKKQRPKSIHRDHIESPKTPVKGPPVSSLSLASLNTGDTESVHSGKRTPRSESVEGFLS
PSRCGSRNGEKDWENASTTSSVASGTEYTGPKLYKEPSAKSNKHIIQNALAHCCLAGKVN
EGQKKKILEEMEKSDANNFLILFRDSGCQFRSLYTYCPETEEINKLTGIGPKSITKKMIE
GLYKYNSDRKQFSHIPAKTLSASVDAITIHSHLWQTKRPVTPKKLVPTKA
Download sequence
Identical sequences 10141.ENSCPOP00000001637 ENSCPOP00000001637 ENSCPOP00000001637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]