SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001688 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001688
Domain Number 1 Region: 42-174
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.54e-48
Family Regulator of G-protein signaling, RGS 0.00000433
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001688   Gene: ENSCPOG00000001864   Transcript: ENSCPOT00000001885
Sequence length 180
Comment pep:known scaffold:cavPor3:scaffold_12:2231212:2252829:1 gene:ENSCPOG00000001864 transcript:ENSCPOT00000001885 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALLMPRRNKGMRTRLGCLSHKSDSCSDFTAILPDKPNRALKRLSTEEATRWADSFDVL
LSHKYGVAAFRAFLKTEFSEENLEFWLACEEFKKTRSTAKLVSKAHRIFEEFVDVQAPRE
VNIDFQTREATRKNMQEPSLTCFDQAQGKVHSLMEKDSYPRFLRSKMYLDLLSQSQRRLS
Download sequence
Identical sequences A0A096MPX4 A0A1S2ZX04 A0A1S3F4R6 A0A1U7UK31 A0A1U8BUQ3 A0A286XN90 A0A287BNH7 A0A287DDG4 A0A2K5KNF8 A0A2K5RAB9 A0A2K5VA51 A0A2K5YH82 A0A2K6APU7 A0A2K6FIC1 A0A2K6S7Y5 E1B7H3 F7HMG9 G3SLJ3 H0WL44 H9EU78 M3W4U0 M3YJE1 W5QCH6
ENSMPUP00000011448 ENSCPOP00000001688 ENSSTOP00000002641 ENSLAFP00000000292 ENSLAFP00000000292 ENSBTAP00000037469 ENSSTOP00000002641 ENSFCAP00000005434 ENSCPOP00000001688 ENSOARP00000020423 ENSSSCP00000016487 10141.ENSCPOP00000001688 9823.ENSSSCP00000016487 ENSOGAP00000002342 ENSMPUP00000011448 ENSCJAP00000008721 XP_002760336.1.60252 XP_003357619.1.46622 XP_003410902.1.64505 XP_003502902.1.69978 XP_003583313.2.59421 XP_003587148.1.76553 XP_003785691.1.62490 XP_003785692.1.62490 XP_003925355.1.74449 XP_004275247.1.21590 XP_004275248.1.21590 XP_004320735.1.83887 XP_004320736.1.83887 XP_004372951.1.4749 XP_004372952.1.4749 XP_004396923.1.74151 XP_004396924.1.74151 XP_004643481.1.9945 XP_004688602.1.23501 XP_004767974.1.14098 XP_005071352.1.91757 XP_005071353.1.91757 XP_005319776.1.77405 XP_005622462.1.84170 XP_005691006.1.57651 XP_005910192.1.15283 XP_005910193.1.15283 XP_005963486.1.78601 XP_006048680.1.26621 XP_006048681.1.26621 XP_006048682.1.26621 XP_006048683.1.26621 XP_006048684.1.26621 XP_006048685.1.26621 XP_006048686.1.26621 XP_006142400.1.99106 XP_006872607.1.41390 XP_006872608.1.41390 XP_006907821.1.64745 XP_006907822.1.64745 XP_006942822.1.62641 XP_007096272.1.5354 XP_007175250.1.59432 XP_007525896.1.11023 XP_007609039.1.28591 XP_007935848.1.48129 XP_007935849.1.48129 XP_007987459.1.81039 XP_007987460.1.81039 XP_007987461.1.81039 XP_008072599.1.4292 XP_008699341.1.72690 XP_008836715.1.79516 XP_008836716.1.79516 XP_008836717.1.79516 XP_008836718.1.79516 XP_008983125.1.60252 XP_010334363.1.74449 XP_010589269.1.64505 XP_010606578.1.5607 XP_010811833.1.76553 XP_010851421.1.44457 XP_011744584.1.29376 XP_011744585.1.29376 XP_011744586.1.29376 XP_011744587.1.29376 XP_011744588.1.29376 XP_011850716.1.47321 XP_011903726.1.92194 XP_011903735.1.92194 XP_011903744.1.92194 XP_011903753.1.92194 XP_011991784.1.54773 XP_011991785.1.54773 XP_011991787.1.54773 XP_011991788.1.54773 XP_011991789.1.54773 XP_011991790.1.54773 XP_012043072.1.66739 XP_012043073.1.66739 XP_012043075.1.66739 XP_012043077.1.66739 XP_012043078.1.66739 XP_012043079.1.66739 XP_012372865.1.9945 XP_012495436.1.63892 XP_012495438.1.63892 XP_012591158.1.48125 XP_012591165.1.48125 XP_012591173.1.48125 XP_012591188.1.48125 XP_012871069.1.60039 XP_012919696.1.14098 XP_012969840.1.91757 XP_012969841.1.91757 XP_013013546.1.53824 XP_013013547.1.53824 XP_013013548.1.53824 XP_013013549.1.53824 XP_013013550.1.53824 XP_013013551.1.53824 XP_013013552.1.53824 XP_013207992.1.66349 XP_013207993.1.66349 XP_013207994.1.66349 XP_013207995.1.66349 XP_013207996.1.66349 XP_013207997.1.66349 XP_013825876.1.57651 XP_013825877.1.57651 XP_013825878.1.57651 XP_013970596.1.84170 XP_014918355.1.86478 XP_014954835.1.66739 XP_014962841.1.54773 XP_014977803.1.72884 XP_014977812.1.72884 XP_014977821.1.72884 XP_015302106.1.63531 XP_015302108.1.63531 XP_015302112.1.63531 XP_015322422.1.59421 XP_015347530.1.40921 XP_015347531.1.40921 XP_016001046.1.101085 XP_016001047.1.101085 XP_017379978.1.71028 XP_017379979.1.71028 XP_017504125.1.32401 XP_017504131.1.32401 XP_017654961.1.79516 XP_017916179.1.57651 XP_019060671.1.5607 XP_019060672.1.5607 XP_019283121.1.44245 XP_019283131.1.44245 XP_019283141.1.44245 XP_019283150.1.44245 XP_019283157.1.44245 XP_019655378.1.58354 XP_019655379.1.58354 XP_019677314.1.62641 XP_019677315.1.62641 XP_020010138.1.5219 XP_020010139.1.5219 XP_020919425.1.46622 XP_020919426.1.46622 XP_020919427.1.46622 XP_020919428.1.46622 XP_020919430.1.46622 XP_020919431.1.46622 XP_020919432.1.46622 XP_020919433.1.46622 XP_021538250.1.83697 XP_021578255.1.77405 XP_021578256.1.77405 XP_021578257.1.77405 ENSSSCP00000016487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]