SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001746 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001746
Domain Number 1 Region: 118-620
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.15e-159
Family Calponin-homology domain, CH-domain 0.00000000272
Further Details:      
 
Domain Number 2 Region: 4-93
Classification Level Classification E-value
Superfamily EF-hand 5.81e-18
Family Calmodulin-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001746   Gene: ENSCPOG00000001937   Transcript: ENSCPOT00000001958
Sequence length 627
Comment pep:known scaffold:cavPor3:scaffold_6:56249069:56276299:-1 gene:ENSCPOG00000001937 transcript:ENSCPOT00000001958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARGSVSDEEMMELREAFAKVDTDGNGYISCNELNDLFKAACLPLPGYRVREITENLMAT
GDLDKDGRLSFDEFIKVFHGLKSADVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSE
EEKYAFVNWINKALENDPDCRHVIPMNPNTNDLFNAVGDGIVLCKMINLSVPDTIDERTI
NKKKLTPFTIQENLNLALNSASAIGCHVVNIGAEDLKEGKPYLVLGLLWQVIKIGLFADI
EISRNEALIALLREGESLEDLMKLSPEDLLLRWANYHLENAGCNKISNFSTDIKDSKAYY
HLLEQVAPKGDEEGIPAVVIDMSGLREKDDIQRAECMLQQAERLGCRQFVTATDVVRGNP
KLNLAFIANLFNKYPALHKPENQDIDWGALEGETREERTFRNWMNSLGVNPRVNHLYSDL
SDALVIFQLYEKIKVPVDWNRVNKPPYPKLGGNMKKLENCNYAVELGKNQAKFSLVGIAG
QDLNEGNRTLTLALIWQLMRRYTLNMLEDIGGGQKVNDDIIINWVNETLKEAEKSSSICS
FKGPRISTSLPVLDLIDAIQPGSINYDLLKTESLNDEEKLNNAKYAISMARKIGARVYAL
PEDLVEVNPKMVMTVFACLMGKGMKRV
Download sequence
Identical sequences H0UXD2
10141.ENSCPOP00000001746 ENSCPOP00000001746 ENSCPOP00000001746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]