SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001950 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001950
Domain Number 1 Region: 571-686
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.4e-18
Family Regulator of G-protein signaling, RGS 0.0033
Further Details:      
 
Domain Number 2 Region: 399-527
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.65e-17
Family Regulator of G-protein signaling, RGS 0.0045
Further Details:      
 
Domain Number 3 Region: 209-331
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.39e-16
Family Regulator of G-protein signaling, RGS 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001950   Gene: ENSCPOG00000002153   Transcript: ENSCPOT00000002181
Sequence length 720
Comment pep:known scaffold:cavPor3:scaffold_0:16235339:16292522:1 gene:ENSCPOG00000002153 transcript:ENSCPOT00000002181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RHIEKMKKCYLVSSGECYLSTEILSKLKLLDGSQWTEEHLKNIQSEVIKPLLLYWAPRFC
ITHLSSTNSASAELRFWHLRQEKPRKDIDPFPQMATLLPLRPKSCNPQISEIQKEEFSSV
QHTKSLKKTTRVKTATQNPWKTESLSVVPQRDAGTERQIRRMSESSRVIRLTSFTDISEC
LKPQLDRKYTYTEEPKVKTISDVGALGGFDMENLLQSLYVESRAGFFFTKFCEDSGNKLW
KNSVYFWFDLQAYHQLFYQETLQPFKVCKQAQYLFATYVAPSATLDIGLQQEKKREIYMK
IHPPFEDLFDTAEEYILLLLLEPWMKMVKSDQVTYRKVELVEESRQLDSTCLRKLQALYK
ESFPKKAGDATDEIGTGLLSLPDISKQTEYWNNVPEEYKHFSFNDLLNNKLEFEHFRQFL
GVHSSSMDLMCWIDIEQFRRINYKDQNQREAKSIYIKKKYLNKKYFFGPNSPASLYQQNE
IMELGGGWGKILHEQLDAPVLIEIQKHILNRLENVWLPLFLASEEFAARQKIKVQMKDIA
DELLLQKHEGKIGVWKPVESKWISSSCEIIAFRKALLNPVTARQFQHFVTLKGDLLGNGV
LFWQEVQKYKDLCHSHCDESVIQKKITTIINCFINSCIPPALQIDIPVEQAQKIIEHRKE
LGPYIFREAQMTIFGVLFKFWPQFCEFRKNLTDEKIMSVLERRQEYNKQKKKLSVIDDEK
Download sequence
Identical sequences ENSCPOP00000001950 ENSCPOP00000001950 10141.ENSCPOP00000001950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]