SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001990 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001990
Domain Number 1 Region: 233-423,610-686
Classification Level Classification E-value
Superfamily SET domain 5.89e-63
Family Histone lysine methyltransferases 0.00068
Further Details:      
 
Domain Number 2 Region: 167-239
Classification Level Classification E-value
Superfamily DNA-binding domain 0.000000000193
Family Methyl-CpG-binding domain, MBD 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001990   Gene: ENSCPOG00000002194   Transcript: ENSCPOT00000002223
Sequence length 696
Comment pep:novel scaffold:cavPor3:scaffold_6:59313084:59348511:1 gene:ENSCPOG00000002194 transcript:ENSCPOT00000002223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRTKKIDAKSFWMELEDDGKVDFIFEKVQNVLQSLKQKIKDGSATNKEYIQAMILVNDAT
ISKNSTLKKCMYISYPNPGANTSRKVDHISVTPREQENKSNVFPSTSSEDSFPKGFTFLN
IENKKNLPLDNKVVECRGKRSPMNLSYQSHHCSCACLMKMPSTTKAENPLQLPIRCHFQR
RHAKTNTHSSALHVNYKAPCGRSLRNIEEVFRYLLETECSFLFTDNFSFNTYVQLTRNYQ
KQEEIVSDVDISKGLELVPISFCNEIDNRKLPQFKYRKTMWPPAYYLNNFSSMFTDSCDC
SEGCIDITKCACLQLTARNAKTSPLSSDKITTGYKYKRLQRQIPTGIYECSLLCKCNRQM
CQNRVVQHGPQVRLQVFKTEKKGWGVRCLDDVDRGTFVCIYSGRLLNRANPKKPNAVEVT
HSDCEAEVTPLELETHLRSAKTEDCPLKSSNNPEELVMKMSCHNISRIQYHSVRSPRSKT
VIFQQSGKQKELTSLDSVTSGENNGFLNCKARRKQKDSSSNQVGDFKDLQLHESDVIDIT
KCEEESPPGDRCNPATTADSENIEKDFEVQIKTPQEEKSPARQKQRALSNDELLSEIKNT
SSTSPVKSSESNMFLLDATKEGNVGRFLNHSCCPNLWVQNFVETHDRNFPLVAFFTNRYV
RARTELTWDYGYEAGTVPNKEILCQCGANKCRKKIL
Download sequence
Identical sequences ENSCPOP00000001990 ENSCPOP00000001990 10141.ENSCPOP00000001990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]