SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002004 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002004
Domain Number 1 Region: 118-187
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000000282
Family VWC domain 0.033
Further Details:      
 
Domain Number 2 Region: 245-320
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000009
Family VWC domain 0.024
Further Details:      
 
Domain Number 3 Region: 60-126
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000481
Family VWC domain 0.0066
Further Details:      
 
Domain Number 4 Region: 588-643
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000018
Family BSTI 0.036
Further Details:      
 
Domain Number 5 Region: 23-67
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000523
Family VWC domain 0.044
Further Details:      
 
Domain Number 6 Region: 197-251
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000534
Family VWC domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002004   Gene: ENSCPOG00000002208   Transcript: ENSCPOT00000002237
Sequence length 646
Comment pep:known scaffold:cavPor3:scaffold_30:21562689:21777154:-1 gene:ENSCPOG00000002208 transcript:ENSCPOT00000002237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NSFISGSVAKCENEGEELQIPFITDNPCIMCVCLNKEVTCRREKCPVLPRDCALAVKQRG
ACCERCKGCTYEGNTYNSSFKWQSPAKPCVLHQCQEGVVTESEVHCVVHCRNPVEHPGAC
CPTCPGCVFGGVQYREGEEFQPEGSKCTKCSCLGGRTQCVREVCPILSCPQHLSHTPPGQ
CCPKCLGQRKVFDLPFGSCLFRSDVYDNGSSFLYDNCTTCTCKDSTVVCKKKCSHPGSCD
RAKEACCEQCLLQVLPEDVSVCKFGNKIFREGEVWSSANCTICACVNGKTECHRKQCVSI
SSCPQGRILNRKGCCPICTEKPGVCTVFGDPHYNTFDGRTFNFQGTCQYVLTRDCASPAS
PFQVLVKNDARRTRSFSWTKSVQLVLGSSIVSLEQHLAVRWNGSRVALPCDGPHFRVDLE
GYLLKVTTRAGLEISWDGDSFVEVMAAPHLKGKLCGLCGNYNGHKRDDLIGGDGSFKFDV
DDFAESWRVESNEFCNRPRRRPVPELCQGTVKVKLRAHRECQKIKSREFQTCHSAVDYTT
FYRSCVTDMCECPAHKNCYCESFLAYARACQREGVRVPWEPQRHCTATQCKHGAVYDTCG
PGCVKTCDTWNEIGPCNKPCVAGCHCPADLVLHRGRCIKPVLCPQR
Download sequence
Identical sequences ENSCPOP00000002004 10141.ENSCPOP00000002004 ENSCPOP00000002004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]