SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002398 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002398
Domain Number 1 Region: 136-471
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.7e-90
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000501
Further Details:      
 
Domain Number 2 Region: 37-121
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000141
Family Anticodon-binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002398   Gene: ENSCPOG00000002639   Transcript: ENSCPOT00000002673
Sequence length 477
Comment pep:known scaffold:cavPor3:scaffold_40:14720690:14859532:1 gene:ENSCPOG00000002639 transcript:ENSCPOT00000002673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGSRVLSRALRFCSSVPCPRHKPSSKLSVRDALGSQNTSGERVKVQGWIRSIRSQKEVL
FLHVNDGSSLESLQIVADASFDSRELTFGSSVEVQGQLVKSLSKKQNVELKAEKIEVIGN
CDAKAFPIKYKERHPLEFLRQYPHLRCRTNVLGSILRVRSEATAAIHSFFKDRGFVHIHT
PVITSNDCEGAGELFQVEPSGKTKIPKENFFNVPAFLTVSGQLHLEVMSGAFTQVFTFGP
TFRAENSQSRRHLAEFYMVEAEISFVENLHDLMQVMEDLFKATTMSVLSNCPEDVELCHK
FIAPGHKDRLEHMLKNNFLIISYTEAIEILRKASHSFTFTPKWGVDLQTEHEKYLVKHCG
DIPVFVTNYPLALKPFYMRDNEDGPQHTVAAVDLLVPVVGELFGGSLREERYHILEQRLA
RSGLTEAYQWYLDLRRFGSVPHGGFGMGFERYLQCILGVDNIKDVIPFPRFTHSCLL
Download sequence
Identical sequences A0A286X998
ENSCPOP00000002398 ENSCPOP00000002398 10141.ENSCPOP00000002398 XP_003468574.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]