SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002726 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000002726
Domain Number - Region: 702-775
Classification Level Classification E-value
Superfamily DEATH domain 0.0033
Family DEATH domain, DD 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002726   Gene: ENSCPOG00000003007   Transcript: ENSCPOT00000003046
Sequence length 811
Comment pep:known scaffold:cavPor3:scaffold_31:2245858:2263981:1 gene:ENSCPOG00000003007 transcript:ENSCPOT00000003046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ECHDPSLHHNWPDASTFYGNNASKAGNPFWNELSASNPFLDDITQQRNSQKRDNVSILKE
DPFLFLREIETGDSFDSSGDELDVHKLLRHSSGNPGRSKSVSELLGILDDTAQLYDDIHS
SNQILVQDLEWLQNDREAYKMAWLSQRQLARSCLDLNAIHQSPGWAQTQVAETTTVCKIN
HQGGSVQLPESDITVHVPQGHVAVGEFQEVSLRAFLDPPKMLNHDLSCTVSPLLEITLSN
LNTMEAILLEMKIGAEVRKDPFSQVMTEMVCLYSLQKEGPFRVLNTCYIYKDTIQVKLMD
FSQVMYLVIAAQAKAIQSPAATIWDYIHKTTSVGIYGPKYIHPSFTAVFTVCGHSYMPGK
LTVSDINKGRKSTSPVVFHLWGKHSFLLNKPQDLSISVFSCDPDFEVKGEAERKEIKRNQ
LETGEVVHQRFLFSLVDHREMHLFVFRVQVDTPDCRPVAQFFITSPDPAPNLKRLSNLPG
CLKEKEVKSAPSLPTLPVKYPTFQDKKMNFTNYGVTLKTVLRQIKLDYLLEYFKGDTIAL
LGEGKVRAMGQTKVKEWYVGVLRGKIGLVHCKNIKVISKEQVMPASDSIFTTRNLLEQIT
LPFKKLTYIYSVVLTLVSENVYGWKVLADVLGYSHLSLQDFDQIQVNKESERVSYVVKKL
KEDCHADRNTRKFLYELVVALLKMDCQGLVAHLIQEAVILTSAVKLGKGWRELAEKLVHL
TKQQMKAYEIPHQGKTGSVAVEIMWKPAYDFLYTWSTQYGNSYRDVLQDLQSALDRMKNP
VTKQWRDLTGVLLLVNCLEVLRGTAFSNSEE
Download sequence
Identical sequences 10141.ENSCPOP00000002726 ENSCPOP00000002726 ENSCPOP00000002726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]