SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002984 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002984
Domain Number 1 Region: 476-671
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.52e-61
Family Nucleotide and nucleoside kinases 0.00013
Further Details:      
 
Domain Number 2 Region: 322-462
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-29
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 3 Region: 119-177
Classification Level Classification E-value
Superfamily L27 domain 1.82e-22
Family L27 domain 0.0000427
Further Details:      
 
Domain Number 4 Region: 253-337
Classification Level Classification E-value
Superfamily PDZ domain-like 6.05e-19
Family PDZ domain 0.000032
Further Details:      
 
Domain Number 5 Region: 184-235
Classification Level Classification E-value
Superfamily L27 domain 0.0000000000318
Family L27 domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002984   Gene: ENSCPOG00000003303   Transcript: ENSCPOT00000003346
Sequence length 675
Comment pep:known scaffold:cavPor3:scaffold_20:12012078:12060057:1 gene:ENSCPOG00000003303 transcript:ENSCPOT00000003346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTSYMNGHVTEESDSEVKNVDLASPEEPRKHREMAVDCPGDLGTRMMPIRRSAQLERIR
QQQEDMRRRREEEGKKQELDLNSSMRLKKLAQIPPKTGIDNPIFDTEEGIVLESPHYAVK
ILEVEDLFSSLKHIQHTLVDSQSQEDILLLLQLVQNKDFQNAFKIHNAVTVHMNKASPPF
PLVSNAQDLAQEVQTVLKPTHQKEGQELTALLNAPHIQALLLAHDKVAEQEMQLEPIADD
RVYESIGQYGGETVKIVRIEKARDIPLGATVRNEMDSVIISRIVKGGAAEKSGLLHEGDE
VLEINGIEIRGKDVNEVFDLLSDMHGTLTFVLIPSQQIKPPPAKETVIHVKAHFDYDPSD
DPYVPCRELGLSFQKGDILHVISQEDPNWWQAYREGDEDNQPLAGLVPGKSFQQQREAMK
QTIEEDKEPEKSGKLWCAKKNKKKRKKVLYNANKNDDYDNEEILTYEEMSLYHQPANRKR
PIILIGPQNCGQNELRQRLMNKEKDRFASAVPHTTRSRRDHEVAGRDYHFVSRQAFEADI
AAGKFIEHGEFEKNLYGTSIDSVRQVINSGKICLLSLRTQSLKTLRNSDLKPYIIFIAPP
SQERLRALLAKEGKNPKPEELREIIEKTREMEQNNGHYFDTAIVNSDLDKAYQELLRLIN
KLDTEPQWVPSTWLR
Download sequence
Identical sequences H0V0J4
ENSCPOP00000002984 ENSCPOP00000002984 10141.ENSCPOP00000002984 XP_003472404.1.53824 XP_013010732.1.53824 XP_013010733.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]