SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002992 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002992
Domain Number 1 Region: 73-203
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.27e-46
Family Regulator of G-protein signaling, RGS 0.00000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002992   Gene: ENSCPOG00000003312   Transcript: ENSCPOT00000003355
Sequence length 211
Comment pep:known scaffold:cavPor3:scaffold_41:7357811:7388071:-1 gene:ENSCPOG00000003312 transcript:ENSCPOT00000003355 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKRQQSQNEGTPAVSQAPGNQRPNNSCCGYMCCCVLRNCILTVRNEERGESTGRPVHTT
KMESIQVLEESQSPTADEVLSWSQSFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACED
LKKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIY
TLMHRDSFPRFLNSQIYKSFVESTAGSSSES
Download sequence
Identical sequences ENSCPOP00000002992 ENSCPOP00000002992 10141.ENSCPOP00000002992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]