SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000003157 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000003157
Domain Number 1 Region: 391-623
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.09e-37
Family Calponin-homology domain, CH-domain 0.00011
Further Details:      
 
Domain Number 2 Region: 87-242,387-471
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.63e-24
Family FAD/NAD-linked reductases, N-terminal and central domains 0.073
Further Details:      
 
Domain Number 3 Region: 976-1007
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000171
Family LIM domain 0.011
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000003157
Domain Number - Region: 1008-1037
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00271
Family LIM domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000003157   Gene: ENSCPOG00000003493   Transcript: ENSCPOT00000003537
Sequence length 1104
Comment pep:known scaffold:cavPor3:scaffold_67:2983333:3069241:1 gene:ENSCPOG00000003493 transcript:ENSCPOT00000003537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMGENEDEKQAQAGQVFENFVQAATCKGTLQAFNTLTRLLDLDPLDHRNFYSKLKSKVTT
WKAKALWYKLDKRGSHKEYKRGKACMNTKCLIVGGGPCGLRTAIELAYLGAKVVVVEKRD
TFSRNNVLHLWPYTIHDLRGLGAKKFYGKFCAGSIDHISIRQLQLILFKVALMLGVEIHV
NVEFVKVLEPPEDQENQKIGWRADFLPADHPLSEFEFDVIIGADGRRNTLEGFRRKEFRG
KLAIAITANFINRNSTAEAKVEEISGVAFIFNQKFFQDLKEETGIDLENIVYYKDCTHYF
VMTAKKQSLLDKGVIINDCIDTELLLCAENVNQDNLLSYAREAADFATNYQLPSLDFAIN
HYGQPDVAMFDFTSMYASENAALVRERQGHPLLVALVGDSLLEPFWPMGTGCARGFLAAF
DTAWMVKSWDQGTPPLEVLAERESLYRLLPQTTPENINKNFEQYTLDPGTRYPNLNSHCV
RPHQVKHLYVTKELDYHPLERFNSLRRSVNLSRRESDIQPSKLLTWCQQQTEGYQHVNVT
DLTTSWRSGLALCAIIHRFRPELINFDSLNEDDAVKNNQLAFDVAEREFGIPPVTTGKEM
ASVQEPDKLSMVMYLSKFYELFRGTPLRPVDSWRKSYGENADLSFAKSSISNNYLNLTLP
RKRTPRGDAQTEENDMNKRRRKGILNLDEPSSFSSRSLGSTQEGGTSKEAGNQNKVKSMA
NQLLAKFEESTRNPTVLRQERRVSGIGKPVPCSSSDSPVDSRCPTPEETTPSPPPPQKRQ
LSSVLVTGQVLRELKQVSTGGECPSRPWRARAKSDLQLGGPENLATLPPACQGALALSGV
LRRLQQVEEKILQKRAQNLANREFHQKNIKEKAAHLASMFGHGDFPQNKLLSKGPSHTHP
PSPPPCLPSPDPAATSSPSTTESASPARKLTVGKVSSGIGAAAEVLVNLYLNDHRPKAQA
TSPDLESIRKAFPPNLGGCDTCYFCKKRVYVMERLSAEGHFFHRECFCCSICATTLRLAT
YAFDCEEGKFYCKPHFIHCKANSKQRKRWTELKQEQEEEGTWQEQEGPRRDTATESSCAV
AAVSTPEGSPPVHFSLPVLHPLLG
Download sequence
Identical sequences 10141.ENSCPOP00000003157 ENSCPOP00000003157 ENSCPOP00000003157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]