SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000003194 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000003194
Domain Number 1 Region: 210-274
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000335
Family VWC domain 0.0065
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000003194
Domain Number - Region: 152-212
Classification Level Classification E-value
Superfamily FnI-like domain 0.000366
Family Fibronectin type I module 0.04
Further Details:      
 
Domain Number - Region: 277-322
Classification Level Classification E-value
Superfamily FnI-like domain 0.0638
Family Fibronectin type I module 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000003194   Gene: ENSCPOG00000003534   Transcript: ENSCPOT00000003578
Sequence length 324
Comment pep:known scaffold:cavPor3:scaffold_102:2709401:2830965:-1 gene:ENSCPOG00000003534 transcript:ENSCPOT00000003578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCSAAMAVGALSSSLLVTCCLMVALCSPSIPLEKLAQAPEQPGQEKREHASRDGPGRLS
ELERAARDEGGGAREGKGKGGRVLSGEAWSKQKQAWAALGGGAESGDWQGRPRGDTPQGE
PPAAAAQDALSPDLVPTPELPEEYAYPDYRGKGCVDESGFVYAIGEKFAPGPSACPCLCT
EEGPLCAQPECPRLHPRCIHVDTSQCCPQCKERKNYCEFRGQTYQTLEEFVVSPCERCRC
EANGEVLCTVSACPQTECVDPVYEPDQCCPICKNGPNCFAETAVIPAGREVKTDECTICH
CTYEEGTWRIERQAMCTRHECRQM
Download sequence
Identical sequences ENSCPOP00000003194 ENSCPOP00000003194 10141.ENSCPOP00000003194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]