SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000003222 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000003222
Domain Number 1 Region: 611-698
Classification Level Classification E-value
Superfamily DEATH domain 1.32e-23
Family DEATH domain, DD 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000003222   Gene: ENSCPOG00000003566   Transcript: ENSCPOT00000003610
Sequence length 1050
Comment pep:novel scaffold:cavPor3:scaffold_43:11919993:11984921:1 gene:ENSCPOG00000003566 transcript:ENSCPOT00000003610 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEVLDVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDS
LRSFSSDRSHTLSHASYLRDSAMMDDAVVIPSHQVSTLAKEAERNSYRLSWGTENLDNVA
LSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMP
PMVEGEGLASRLIEVGPSGAQFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCE
YTEDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVL
SSTVVPQVQAVFPEGALTKRIRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHK
PITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSF
TTNVSASRFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMT
DDKVDKTLEQQENFAEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENR
LPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESESDQEQEEEID
MTSEKNPQDEQERIEERLAYAADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHA
LLKYWLERDGQHATDASLIECLTKINRMDIVHLMGTSAEPLQGLISHSYAEIEQTITLDH
SEGFSVLQEELCTTQHKLQEEQAASSEGEAGDHPPIVSEEDVSVGYSTFQDCVPKTEGDN
SAAALSPQMHQEQIQQDFSGKTQDASDEQQAYFVTSPGTERTPGSPSRTPEEIGTPSEED
RLDLRTPLSSERGGSPIVQEPEEPPEMREESSPWKTSLVIVESGEAQPHTFLGPDGDTAL
EKGDDMPEIPPESVTEEEYVDEHGHTVTRKVTRKIIRRYMSSDGTEKEEVTMQGAPPEPV
SIEQGDGYSRVLKRVVLESDSSQSEVTLSEPSILSSTSQFQAEPVEGRRVSKVVKTTVVR
GERMEKHLGDSDLATDLPSAKDDFEEVEKH
Download sequence
Identical sequences ENSCPOP00000003222 ENSCPOP00000003222 10141.ENSCPOP00000003222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]