SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000003227 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000003227
Domain Number - Region: 52-114
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000914
Family I set domains 0.034
Further Details:      
 
Domain Number - Region: 275-315
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0259
Family TNF receptor-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000003227   Gene: ENSCPOG00000003572   Transcript: ENSCPOT00000003616
Sequence length 327
Comment pep:known scaffold:cavPor3:scaffold_53:10487162:10499183:1 gene:ENSCPOG00000003572 transcript:ENSCPOT00000003616 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMGAWLLLPAMLYYLAGTGWPRSSLLSDKGLVYGRLGHPVKIYVKLHQNSPILVCMDSHR
ASEETVDPTYLWIGPNEKMLTGNKQFNITETGTLIVKDFLELLSGLYTCTLSYKTIKAET
QEETIEKKRYDFMVFAYREPDYSYQMAVRFTTKSCVGTYNNQLFRLLRKILNNLISDLSC
HVIEASYKCHVVEIPENDLMHELFIAFQVNPFAPGWRDACGGSVDCEDVTNQNILKARDR
IEEFFRSQASISSHRFNKTVPAIHFVDHSFHVVRIDSCRPGFGKNEGLHSNCASCCVVCS
PGTFSPDVDVTCQICISVHIYGAKSCP
Download sequence
Identical sequences ENSCPOP00000003227 10141.ENSCPOP00000003227 ENSCPOP00000003227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]