SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000003238 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000003238
Domain Number 1 Region: 197-509
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.1e-87
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000768
Further Details:      
 
Domain Number 2 Region: 1022-1289
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.1e-71
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000771
Further Details:      
 
Domain Number 3 Region: 504-707
Classification Level Classification E-value
Superfamily Ribosomal protein L25-like 8.89e-52
Family Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain 0.00047
Further Details:      
 
Domain Number 4 Region: 1292-1421
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.8e-29
Family Anticodon-binding domain of Class II aaRS 0.00015
Further Details:      
 
Domain Number 5 Region: 50-162
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.38e-17
Family Glutathione S-transferase (GST), C-terminal domain 0.053
Further Details:      
 
Domain Number 6 Region: 1425-1512
Classification Level Classification E-value
Superfamily C-terminal domain of ProRS 2.75e-17
Family C-terminal domain of ProRS 0.0061
Further Details:      
 
Domain Number 7 Region: 752-805
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 2e-16
Family a tRNA synthase domain 0.000095
Further Details:      
 
Domain Number 8 Region: 824-878
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 0.00000000000000981
Family a tRNA synthase domain 0.00014
Further Details:      
 
Domain Number 9 Region: 904-955
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 0.0000000000000432
Family a tRNA synthase domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000003238   Gene: ENSCPOG00000003586   Transcript: ENSCPOT00000003630
Sequence length 1512
Comment pep:known scaffold:cavPor3:scaffold_13:2564215:2618596:1 gene:ENSCPOG00000003586 transcript:ENSCPOT00000003630 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATLCLTVNAGAPPLEALLTAEHVKGDVSISVEEGKENILRVSENVAFADINSILRYLAR
VATTAGLYGANLMEHAEIDHWLEFSATKLSSCDLFTSAIDELNHCLSLRTFLVGNSLTLA
DFCVWATLKGSAAWQEESKQSKGPVHVRRWFSFLEAQQAFQSVSAKWGIAANKARVAPEK
KQDIGKFVELPGAEMGKVTVRFPPEASGYLHIGHAKAALLNQHYQVNFKGKLIMRFDDTN
PEKEKEDFEKVILEDVAMLHIKPDQFTYTSDHFETIMKYAEKLIKEGKAYVDDTPAEQMK
AEREQRVESRHRNNSVEKNLQMWEEMKKGSQFGQSCCLRAKIDMSSNNGCMRDPTLYRCK
IQPHPRTGSRYNIYPTYDFACPIVDSIEGVTHALRTTEYHDRDEQFYWIIEALGIRKPYI
WEYSRLNLNNTVLSKRKLTWFVNEGLVDGWDDPRFPTVRGVLRRGMTVEGLKQFIAAQGS
SRSVVNMEWDKIWAFNKKVIDPVAPRYVALLKKEAVPVNIPEAQEEMKEVARHPKNPEVG
LKPVWYSSRVLIEGADAQTLAEGETVTFINWGNISITSIHKNADGKIVSLDGKLNLENKD
YKKTTKITWLAETTRALPTPTICVTYEHLITKPVLGKDEDFKQYVNKNSKREELMLGDPC
LKDLKKGDIIQLQRRGFFICDEPYEPTSPYSCKEAPCVLIYIPDGHTKEMPTSGSKEKTK
GEATKTEQDKLFRNMSLPPVNKSGASSEDPLVLHKRVAAQGDMVRELKAKKAAKEDIDAA
VKQLLALKAEYKEKTGQEYKPGHPPAAGAQDVSCRSLATVQESRSLYDKVAVQGELVRKL
KAEKALKAKINEAVECLLSLKAEYKAKTGKEYVPGQPPSAVSSEARPAGSCEPAGPESLE
ARALYDRVAAQGEAVRKLKAEEAPADQVDAAVQVLLQLKAQYKALAGVEYKPVSATGAED
RGKKKKEKENKSEKQNKPQTPNGSHGKDSSKSQGSGLAPSGAGEGQGPKKQTRLGLEAKK
EENLADWYSQVITKSEMIEYYDVSGCYILRPWAYSIWESIKAFFDAEIKKLGVENCYFPI
FVSQSALEKEKTHIADFAPEVAWVTRSGKTELAEPIAIRPTSETVMYPTYAKWVQSHRDL
PIRLNQWCNVVRWEFKHPQPFLRTREFLWQEGHSAFATFEEAAEEVMQILELYARVYEEL
LAIPVVRGRKTEKEKFAGGDYTTTVEAFISASGRAIQGGTSHHLGQNFSKMCEIIFEDPK
SPGEKQFAYQCSWGLTTRTIGVMVMVHGDNTGLVLPPRVAAIQVVIIPCGITNALSEEDK
EALLAKCEDYRRRLLGADVRARVDLRENYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFV
AVRRDTGEKLTVAESEAEPRLQAMLEEIQAHLFQRALEDLKTHMVVVNTMEDFQKTLDAG
KIAQIPFCGEIECEDWIKKTTARDQDLEPGAPSMGAKSLCIPFQPLQELPPGARCVCSRN
PAKFYTLFGRSY
Download sequence
Identical sequences ENSCPOP00000003238 ENSCPOP00000003238 10141.ENSCPOP00000003238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]