SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000003527 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000003527
Domain Number 1 Region: 19-117
Classification Level Classification E-value
Superfamily DEATH domain 4.71e-21
Family Caspase recruitment domain, CARD 0.015
Further Details:      
 
Domain Number 2 Region: 1012-1152
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000563
Family Nucleotide and nucleoside kinases 0.0027
Further Details:      
 
Domain Number 3 Region: 682-762
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000437
Family PDZ domain 0.016
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000003527
Domain Number - Region: 179-440
Classification Level Classification E-value
Superfamily Tropomyosin 0.000405
Family Tropomyosin 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000003527   Gene: ENSCPOG00000003908   Transcript: ENSCPOT00000003952
Sequence length 1157
Comment pep:known scaffold:cavPor3:scaffold_30:10071052:10100458:1 gene:ENSCPOG00000003908 transcript:ENSCPOT00000003952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAGGGPEMDEYMETLKDEEDALWENVECNRHMLSRYINPAKLTPYLRQCKVIDEQDEDEV
LNAPMLPSKINRAGRLLDILHTKGQRGYVVFLESLEFYYPELYKLVTGKEPTRRFSTIVV
EEGHEGLTHFLMNEVIKLQQQMKAKDLQRCELLAKSRQLEDEKKQLMLTRVELLTFQDRY
YKMKEERDSYNDELVKVKDDNYNLAMRYAQLSEEKNMAVMRSRDLQLEIDQLKHRLNKME
EECKLERNQSLKLKNDIESRPKKEQVLELERENEMLKTKIQELQSIIQAGKRSLPDSNKA
ILDILEHDRKEALEDRQELVNKIYNLQEEVRQAEELRDKYLEEKEDLELKCSTLGKDCEM
YKHRMTTVMLQLEEVERERDQAFHSRDEAQTQYSQCLIEKDKYRKQIRELEEKNDEMRIE
MVRREACIVNLESKLRRLSKDSGTLDQSLPRNLPATIISQSFGDASPRTNGQEADDSSTS
EESPEDSKYFPPYHPPRRRMNLKGIQLQRAKSPISLKRASDFQVKGHGDDSTDASPSSAH
SLPITSSFSKMQPHRSRSSIMSITAEPPGNDSIVRRCKEDAPPRSAVEEDNDSCGFDALD
LDAQSLAQNSAGPDGPHSSADDSHHQSESLDAYDLEQVNLMFRKFSLERPFRPSVTSVGQ
VRGSGPSVQHVTLSGDGLVNQLTLLGGNARGSFVHAVKQGSLAEKAGLHQGHQLLLLEGC
IRGERQSVPLDTCTKEEARWTIQRCSGPVTLHYKVNHEGYQRLLKDMEEGLITSGDSFYI
RLNLNISSQLDACSMSLKCDDIVHVRDTMYQDRHEWLCARVDPFTNHDLDMGTIPSYSRA
QQLLLVKLQRLMHRGSREETDSSSHHTLRVLRNTLQPEEPLSTSDPRVSPRLSRASFLFG
QLLQFVSRSENKYKRMNSSERVRVISGSPLGSLARTSLDATKLSAEKQEELDPESELSKN
LSLIPYSLVRAFHCERRRPVLFTPTMLAKTLVQKLLNSGGAMEFTLCKSDIVTREEFLKK
QKTETIIYSREKNPNTFECIVPANIEAVAAKNKHCLLEAGIGCVRDLIKCGIYPIVLFVR
VCEKNIKRFRKLLPRPETEEEFLRTCRLREKELEALPCLYATVEAEAWSSVEELLRVLKD
RICEEQRKTIWVDEDQL
Download sequence
Identical sequences ENSCPOP00000003527 ENSCPOP00000003527 10141.ENSCPOP00000003527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]