SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000003535 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000003535
Domain Number 1 Region: 30-218
Classification Level Classification E-value
Superfamily HCP-like 3.4e-27
Family HCP-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000003535   Gene: ENSCPOG00000003916   Transcript: ENSCPOT00000003960
Sequence length 231
Comment pep:known scaffold:cavPor3:scaffold_112:4152130:4168339:-1 gene:ENSCPOG00000003916 transcript:ENSCPOT00000003960 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGLVDFQDEEQVKSFLENLEVECNYQCYREKDPDGCYRLVDYLEGIQKNFDEAAKVLKF
NCEDNQHSDSCYKLGAYHVTGKGGLTQDLKAAFRCFLMACEKPGKKSAEACHNVGLLAQD
GQVNEDDQPDLGKARDYYTRACDGGYAPSCFNLSAMFLQGAPGFPKDMALACQYSMKACD
LGHVWACANASRMYKLGDGVDKDEVKAEVLKNRARQLHKEQQKSVQPLTFG
Download sequence
Identical sequences A0A286XUN5
10141.ENSCPOP00000003535 ENSCPOP00000003535 XP_003463120.1.53824 ENSCPOP00000003535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]