SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000003546 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000003546
Domain Number 1 Region: 628-708
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.65e-27
Family DIX domain 0.0000946
Further Details:      
 
Domain Number 2 Region: 2-80
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 8.68e-17
Family Regulator of G-protein signaling, RGS 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000003546   Gene: ENSCPOG00000003927   Transcript: ENSCPOT00000003971
Sequence length 708
Comment pep:known scaffold:cavPor3:scaffold_71:2020579:2047250:-1 gene:ENSCPOG00000003927 transcript:ENSCPOT00000003971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLRVAKAIYKRYIENNSIVSKQLKPATKTYIRDGIKKQQIDSIMFDQAQTEIQLVMEENA
YQMFLTSDIYLEYVRSGGENTAYMSNTGLGSLKVLCGYLPTLNEEEEWTCADFKCKLSPT
VVGLSSKTLRATVGVRSMETVENGYRSFKRSDPVNPYHVGSGYVFAPATSANDSEISSDA
LTDDSMSMTDSSVDGIPPYRVGSKKQLQREMHRSVKANGQVSLPHFPRTHRLPKEMAPVE
PAAFAAELISRLEKLKLEMESRHSLEERLQQIREDEEKEVSEQALTSRDGAPAQPPLSLL
PSSSYEEDPQTILDDHLSRVLKTPGCQSPGVGRYSPRSRSPDHCHQQYHSLPPGGKLPPA
AACPLLRVKGFLTKQTTKHVHHHYIHHHAIPKTKEEIEAEATQRVRCFCPGSTEYYCYSK
CKSHARAPEPVPGELFGGSRGSALPKRNGKVTDPSLALPTREGGPPSGAGALQLPGEEGD
RSQDVWQWMLESERQSKPKPHSAQSTKKAYPLESSRASPGEQVSRHHLWGSSGHSRTAPR
THPFAQDPAMPPLSPPNTLAQLEEACRRLAEVSKPSKQRCCVSSQQRDRNHTATGQARAT
LFSTPGLAPEDYKEPKKLAGVHALQASELVVTYFFCGEEIPYRRMLKAQNLTLGHFKEQL
SKKGNYRYYFKKASDEFACGAVFEEIWDDETVLPMYEGRILGKVERID
Download sequence
Identical sequences ENSCPOP00000003546 10141.ENSCPOP00000003546 ENSCPOP00000003546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]