SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000003641 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000003641
Domain Number 1 Region: 50-188
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.53e-38
Family Regulator of G-protein signaling, RGS 0.0000901
Further Details:      
 
Domain Number 2 Region: 361-463
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.31e-32
Family Ras-binding domain, RBD 0.0000319
Further Details:      
 
Domain Number 3 Region: 305-374
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.51e-20
Family Ras-binding domain, RBD 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000003641   Gene: ENSCPOG00000004036   Transcript: ENSCPOT00000004080
Sequence length 549
Comment pep:known scaffold:cavPor3:scaffold_17:23093930:23106856:1 gene:ENSCPOG00000004036 transcript:ENSCPOT00000004080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGKPKHLGVPNGRMVLAVSDGELSSTAGSQAQGEGRGSSLSIHSLPSGPSSPFTTEEQP
VASWALSFERLLQDPLGLAYFTEFLKKEFSAENVTFWMACERFQQIPASNTEQLAQEARN
IYEEFLSSQALSPVNIDRQAWLGEEVLAQPRPDMFRAQQLQIFNLMKFDSYARFVKSPLY
RECLLAEAEGRPLREPGSSSLGSPDTTRKKPKLKPGKSLPLGVEELGHLPLPEGPGGRPL
RKSFRRELDGKATNLALRRESQGSLNSSASLDLGFLAFISNKSESQSHRKSLGSTEGETE
SRPGKYCCVYLPDGTASLALARPGLTIRDMLAGICEKRGLSLPDIKVYLVGNEQKPLVLD
QDCTVLADQEVRLENRITFELELVALERVVRISAKPTKRLHEALQPILAKHGLSLEQVAL
HRPGETQLLDLEKLVSSVAAQRLVLDTLPGAKICEASNITPCSNQGHTPKTKDKATHLPP
QPPASLLQVPSSATGKRQTCDIEGLVELLNRVQSCGAHDQRGLLRKEDLVLPEFLQLPAQ
QPSSPEAPP
Download sequence
Identical sequences 10141.ENSCPOP00000003641 ENSCPOP00000003641 ENSCPOP00000003641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]