SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000003649 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000003649
Domain Number 1 Region: 184-526
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.18e-86
Family Protein kinases, catalytic subunit 0.000000272
Further Details:      
 
Domain Number 2 Region: 31-181
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 8.41e-42
Family Regulator of G-protein signaling, RGS 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000003649   Gene: ENSCPOG00000004047   Transcript: ENSCPOT00000004091
Sequence length 589
Comment pep:known scaffold:cavPor3:scaffold_17:23155297:23169321:1 gene:ENSCPOG00000004047 transcript:ENSCPOT00000004091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELENIVANTVLLKAREGGGGNRKGKSKKWRQMLQFPHISQCEELRLSLERDYHSLCERQ
PIGRLLFREFCATRPELTRCTAFLDGVAEYEVTPDEKRKACGQRLMQTFLSHTGPDLIPE
VPLQLVTNCAQRLEEGPCKDLFQELTRLTHEYLSMAPFADYLDSIYFNRFLQWKWLERQP
VTKNTFRQYRVLGKGGFGEVCACQVRATGKMYACKKLEKKRIKKRKGEAMALNEKQILEK
VNSRFVVSLAYAYETKDALCLVLTLMNGGDLKFHIYHMGQAGFPEARAVFYAAEICCGLE
DLHRERIVYRDLKPENILLDDHGHIRISDLGLAVHVPEGQTIKGRVGTVGYMAPEVVKNE
RYTFSPDWWALGCLLYEMIAGQSPFQQRKKKIKREEVERLVKEVPEEYSERFSPQACSLC
SQLLCKDPAERLGCRGSGAQEVKEHPLFKKLNFKRLGAGMLEPPFKPDPQAIYCKDVLDI
EQFSTVKGVELEPTDQDFYQKFATGSVPIPWQNEMVETECFQELNVFGLDGSVPPDLDWK
GQPPAPPKKGLLQRFFSRQRTAVGTAATVRKSSPPASSPQPEAPTSGWR
Download sequence
Identical sequences ENSCPOP00000003649 ENSCPOP00000003649 10141.ENSCPOP00000003649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]