SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000003814 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000003814
Domain Number 1 Region: 22-151,185-292
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.78e-78
Family Calponin-homology domain, CH-domain 0.0000542
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000003814   Gene: ENSCPOG00000004228   Transcript: ENSCPOT00000004273
Sequence length 592
Comment pep:known scaffold:cavPor3:scaffold_114:108103:180108:1 gene:ENSCPOG00000004228 transcript:ENSCPOT00000004273 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAQEWDWFQREELIGQISDIRVQNLQVERENVQKRTFTRWINLHLEKCDPPLEVTDLFV
DIQDGKILMALLEVLSGRNLLHEYKSSSHRIFRLNNIAKALTFLEDSNVKLVSIDAAEIA
DGNPSLVLGLIWNIILFFQIKELTGNLSRNSPSSSLSPGSGGTDSDSSYPPTPTAESNVA
IAMKDQRKAIKTLLAWVQRKTRKYGVAVQDFAGSWRSGLAFLAVIKAIDPSLVDMKQALE
ESPRENLERAFQVAQETLHIPRLLEPEDIMVDVPDEQSIVTYVAQFLERFPELEAEDFMD
PDKEVPIESTFVRIRETPPEQESKVLLLMQNGERTYTVNHETSHPPPTKVFLCDRPEGMA
SSVLSDSSTEFVHQIIDQVLQEGLGTSSEPAPESSNLCPRRNSQRPSFLPTKKTVHFEDG
AYKEPSGSQEPFYSPHFVFEGSPRPSRELLQQGRRALLEAEAEERKLEEAASPIPGAGSG
EVPGAHGPVSPTQPPPDSSSLNGTYEDLAGHLGEENPSLQPLGVNTVLASSMEIKVKLQT
AEPMGTEDYLEGVPSQARRFVSDSVDFASTSQGSGETSPGEKATGKEEAVEA
Download sequence
Identical sequences 10141.ENSCPOP00000003814 ENSCPOP00000003814 ENSCPOP00000003814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]