SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004149 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004149
Domain Number 1 Region: 752-1054,1094-1148,1192-1247
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.88e-70
Family Calponin-homology domain, CH-domain 0.0015
Further Details:      
 
Domain Number 2 Region: 1670-1778
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000248
Family Motor proteins 0.066
Further Details:      
 
Domain Number 3 Region: 1244-1360
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000611
Family Motor proteins 0.049
Further Details:      
 
Domain Number 4 Region: 2220-2301
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000226
Family Motor proteins 0.019
Further Details:      
 
Domain Number 5 Region: 1603-1694
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000234
Family Motor proteins 0.027
Further Details:      
 
Domain Number 6 Region: 1850-1926
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000239
Family Motor proteins 0.051
Further Details:      
 
Domain Number 7 Region: 1777-1847
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000292
Family Motor proteins 0.031
Further Details:      
 
Domain Number 8 Region: 1511-1598
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000372
Family Extended AAA-ATPase domain 0.071
Further Details:      
 
Domain Number 9 Region: 2289-2358
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000398
Family Motor proteins 0.044
Further Details:      
 
Domain Number 10 Region: 1982-2065
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000823
Family Motor proteins 0.046
Further Details:      
 
Domain Number 11 Region: 2359-2428
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000135
Family Motor proteins 0.023
Further Details:      
 
Domain Number 12 Region: 2068-2143
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000743
Family Motor proteins 0.045
Further Details:      
 
Domain Number 13 Region: 1926-2001
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000109
Family Motor proteins 0.044
Further Details:      
 
Domain Number 14 Region: 2138-2215
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000717
Family Motor proteins 0.057
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000004149
Domain Number - Region: 1451-1514
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000127
Family Motor proteins 0.035
Further Details:      
 
Domain Number - Region: 2435-2474
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0398
Family Motor proteins 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004149   Gene: ENSCPOG00000004603   Transcript: ENSCPOT00000004652
Sequence length 2474
Comment pep:novel scaffold:cavPor3:scaffold_12:25051181:25092939:1 gene:ENSCPOG00000004603 transcript:ENSCPOT00000004652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATRPAGRSCWELSPAERMPRAGRKKPAEAPESPAVLSLSHFCRSPFLCFGDVRPGTSRT
LPLVLQNPNEEVAEVEVAHLPAAELGFSVWPRHCVVQPTEKVVISVNWTPLKEGRVREIV
VFLVNNVLKHQAILLGNAEEQKKKKKSLWDTINKKTVSASSTRNKKISNTQNINKTFSVS
QKVDRVRSPLQACENVAMNEGSAPTENSSLTLEESKIPISPISPVFKECHVETCLPFSVR
RSTTYSSLHASGNREQIQVESAIVSKDFNLDEKIITEHSINTSGQSEVNTNLILTPNCSS
PLNIIGTQGNFINPDSFVTNSHAANNDVGLMTCLLSDTITKDNLKTVHLESKTVHKIYQT
ILSPDSFVNGNYGLNHDLESESVKPFLSPSQFVKDNMPHIYTAQQTCKDSPLSNENSQIP
PFPQDWIKSEVFPCDPECQGSKTSQFILEELNPEAMKSHYHSFTKQSHPKFSAVKQPKRR
PILSATVTKRKQVCTGESQAVVNKPKAKRCLNSTVEECEKVIDNQKEKEAFHKYLPVIDP
ELTTPQSYKSETTSSTSLFARKRKSDRNMEDANVKVVREHTEVHKVKRIHFSPSESNSST
LKTKKMTTPISKHFKSREKLSSKKKTDLLGFKTPTYKTTKRTKSIVAVAQSNLTFIKPLK
TDIPRHPMPFAAKNMFYDERWKEKQEQGFTWWLNFILTPDDFTVNTNVSEVNAATLLLGV
ENQHKISVPRAPTKDEMSLRAYTARCRLNRLRRTACHLFTSEKMVKAIKKLEIEIEAKRL
IVRKDRHLWKDVGERQKVLNWLLSYNPLWLRIGLETVYGELISLEDNSDVTGLAVFILNR
LLWNPDIAAEYRHPSVPHLYRDGHEEALSRFTLKKLLLLVCFLDHAKMSKLIDHDPCLFC
KDAEFKASKEILLAFSRDFLSGEGDLSRHLSLLGLPVSHVQTPFDEFDFAVTNLAVDLQC
GVRLVRTMELLTQNWNLSKKLRMPAISRLQKMHNVDIVLQILKSRGIQLSDEHGNTILSK
DIVDRHREKTLGLLWKIAFAFQVEISLNLDQLKEEINFLKDTQSIKKTMSASSCHSDAVK
NKKKDQGHSSTLHHYSESVKLLMDWVNSVCAFYEKKVENFTVSFSDGRVLCYLIHHYHPC
YVPFDAICQRTTQTVECTQTGSVVLNSSSESDDSYFDMSHKAPDHENNTELYKELLENEK
KNFHLVRSAVRDLGGIPAMIHHSDMSNTIPDEKVVIMYLSFLCARLLDLRKEIRAARLIQ
TTWRKYKIKRDLKHLQERDKAARIIQSSVISFLAKRRLKKKVNAALIIQKCWRRVLAQRR
LLMLRREKLEKIQNKSASVIQGYWRRYSARKRFLKLKYYSVILQSRIRMIIALTAYKRCL
WATVTIQRHWRASLRRKQDQERYKMLKSSVLIIQARFRRWKRRKMQLQIKAVVVLQRAFR
EWHFRKQAKEKSAIVIQSWYRMHKELQKYIYIRSCVVIIQRRFRCFQVQKLYKRKIKSIL
TIQKYYRAYLKGRTERTSYLQKRAAAIRLQAAFRRMKAHNLQKQMRAACVLQSYWRMRQD
KFRFLNLKNSVIKLQAYIRKHQQLQKYKKMRKAAIVIQTRFRAYILAKKVQASYKKTRSA
VIVLQSAYRGMRARKMFLHILTSVIKIQSYYRAYISRKKFLSLKSSAIKFQSIFKMKQAR
RQYLHVRKAALFIQQWYRSQKMTAQKREEYMQMRESCITLQAFCRGYLVRKQMSLQRKAA
ISLQSYFRMRKLRQHYLKTYKAIVVIQSYYRAYKAQVNLRNNFLQIKRAATCLQAGYRGY
KVRQIIKQQSIAALTIQTAFRGYSKRVKYQSVLQSTVKIQRWYRACMLVYDMRRDFLKTR
AAVLSLQSAYRGWKVRKQVQKEHQAAIKIQSVFRMTKAQKQFRLLKTATVIIQQHLRALN
AGRKQRMEYIKLRNAVVMLQSTWKGKTLRRQIQKQHSCAVIIQSYYRMHVQRKKWKIMKN
AIRLIEMYYRAYSIGRKERHLYLKKKAAIVTLQSAYRGMKVRKGMKDHNKAAVTIQSKYR
AYKTQKKYATYRASAIVIQRWYRSIKNANHQHKQYLNLKKAAIKIQAVYRGIRVRRHIQH
LHMAATSIKAMFKMHKSRVRYHAMRRAAIVIQRRYRAYYQGKIQREKYLTILKAVSTLQA
SFRGARVRQALRKMQISATLIQSYYRRYRQQTYFNKLKKVTKTIQQRYRAVKERNVQLQR
YTKLRHSVICIQSAFRGMKARRHLKAKHLAAILIQKQFRALLVRKKFLSLKKTVIWIQRK
YRAKHHLQQYLQLRKAVIKIQASYRGWMVRKRIQEMRRAATLIQAVFRMHRNYVTFRTWK
HAAIQIQRHYRKYRATKLQRENLIRQWHSAVVIQAAYKGMKARQILRKQNEAAIIIQKHF
KGFKTRKHYLHLRATVISVQRRYRMLTATSTQAGRFIRQRRAAVTLQHFFRTWQTRKRFL
QYRKAAVVLQNHYR
Download sequence
Identical sequences ENSCPOP00000004149 10141.ENSCPOP00000004149 ENSCPOP00000004149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]