SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004159 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004159
Domain Number 1 Region: 172-499
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.03e-95
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000128
Further Details:      
 
Domain Number 2 Region: 26-151
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.35e-32
Family Anticodon-binding domain 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004159   Gene: ENSCPOG00000004614   Transcript: ENSCPOT00000004663
Sequence length 500
Comment pep:known scaffold:cavPor3:scaffold_3:50938723:51001028:1 gene:ENSCPOG00000004614 transcript:ENSCPOT00000004663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSASASRRSQEKPREIMDAAEDYAKERYGISSMIQSQEKPDRVLALVKDLTIQKADEVV
WVRARVHTSRAKGKQCFLVLRQQQFNVQALVAVGDHASKQMVKFAANINKESIVDVEGIV
RKVNQKIGSCTQQDVELHVQKIYVISLAEPRLPLQLDDAVRPEVGEEEGRATVNQDTRLD
NRVIDLRTSTSQAIFRLQSGICYLFRETLNNKGFVEIQTPKIISAASEGGANVFTVSYFK
NNAYLAQSPQLYKQMCICADFDKVYCIGPVFRAEDSNTHRHLTEFVGLDIEMAFNYHYHE
VLEEIADTLVQIFKGLQERYQTEIQTVNKQFPCEPFKFLEPTLRLEYCEALAMLREAGVE
MGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNSYDMFMR
GEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLERVTMLFL
GLHNVRQTSMFPRDPKRLTP
Download sequence
Identical sequences H0V3J6
ENSCPOP00000004159 ENSCPOP00000004159 XP_005007764.1.53824 10141.ENSCPOP00000004159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]